Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5347
Gene name
LocationContig_489:8938..13262
Strand+
Gene length (bp)4324
Transcript length (bp)4194
Coding sequence length (bp)4194
Protein length (aa) 1398

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02738 MoCoBD_1 Molybdopterin cofactor-binding domain 8.7E-98 763 998
PF20256 MoCoBD_2 Molybdopterin cofactor-binding domain 1.5E-88 1026 1293
PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase 2.9E-46 293 468
PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain 8.2E-31 477 581
PF01315 Ald_Xan_dh_C Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain 4.3E-30 636 745
PF01799 Fer2_2 [2Fe-2S] binding domain 5.4E-30 130 202
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 1.6E-07 53 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C4NYZ3|AOXB_MACFA Aldehyde oxidase 2 OS=Macaca fascicularis GN=AOX2 PE=2 SV=2 52 1393 0.0E+00
sp|Q5FB27|AOXA_MACFA Aldehyde oxidase 1 OS=Macaca fascicularis GN=AOX1 PE=2 SV=2 50 1387 0.0E+00
sp|Q9Z0U5|AOXA_RAT Aldehyde oxidase 1 OS=Rattus norvegicus GN=Aox1 PE=1 SV=1 50 1393 0.0E+00
sp|Q06278|AOXA_HUMAN Aldehyde oxidase OS=Homo sapiens GN=AOX1 PE=1 SV=2 50 1393 0.0E+00
sp|P80456|AOXA_RABIT Aldehyde oxidase 1 OS=Oryctolagus cuniculus GN=AOX1 PE=1 SV=2 50 1393 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C4NYZ3|AOXB_MACFA Aldehyde oxidase 2 OS=Macaca fascicularis GN=AOX2 PE=2 SV=2 52 1393 0.0E+00
sp|Q5FB27|AOXA_MACFA Aldehyde oxidase 1 OS=Macaca fascicularis GN=AOX1 PE=2 SV=2 50 1387 0.0E+00
sp|Q9Z0U5|AOXA_RAT Aldehyde oxidase 1 OS=Rattus norvegicus GN=Aox1 PE=1 SV=1 50 1393 0.0E+00
sp|Q06278|AOXA_HUMAN Aldehyde oxidase OS=Homo sapiens GN=AOX1 PE=1 SV=2 50 1393 0.0E+00
sp|P80456|AOXA_RABIT Aldehyde oxidase 1 OS=Oryctolagus cuniculus GN=AOX1 PE=1 SV=2 50 1393 0.0E+00
sp|Q5SGK3|AOXB_MOUSE Aldehyde oxidase 2 OS=Mus musculus GN=Aox2 PE=1 SV=2 44 1393 0.0E+00
sp|H9TB17|AOXA_CAVPO Aldehyde oxidase 1 OS=Cavia porcellus GN=AOX1 PE=1 SV=2 48 1393 0.0E+00
sp|Q5QE78|AOXB_RAT Aldehyde oxidase 2 OS=Rattus norvegicus GN=Aox2 PE=2 SV=1 50 1393 0.0E+00
sp|Q5QE80|AOXC_RAT Aldehyde oxidase 3 OS=Rattus norvegicus GN=Aox3 PE=1 SV=1 52 1391 0.0E+00
sp|R4ZGN4|XDH_BLAAD Xanthine dehydrogenase OS=Blastobotrys adeninivorans GN=AXOR PE=1 SV=1 45 1395 0.0E+00
sp|G3X982|AOXC_MOUSE Aldehyde oxidase 3 OS=Mus musculus GN=Aox3 PE=1 SV=1 52 1391 0.0E+00
sp|H9TB18|AOXD_CAVPO Aldehyde oxidase 4 OS=Cavia porcellus GN=AOX4 PE=2 SV=2 52 1393 0.0E+00
sp|Q3TYQ9|AOXD_MOUSE Aldehyde oxidase 4 OS=Mus musculus GN=Aox4 PE=1 SV=1 52 1393 0.0E+00
sp|H9TB19|AOXB_CAVPO Aldehyde oxidase 2 OS=Cavia porcellus GN=AOX2 PE=2 SV=2 52 1352 0.0E+00
sp|Q5QE79|AOXD_RAT Aldehyde oxidase 4 OS=Rattus norvegicus GN=Aox4 PE=2 SV=1 52 1393 0.0E+00
sp|Q960A1|GAD3_CAEEL Probable aldehyde oxidase gad-3 OS=Caenorhabditis elegans GN=gad-3 PE=3 SV=3 50 1374 0.0E+00
sp|Q12553|XDH_EMENI Xanthine dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hxA PE=2 SV=2 39 1397 0.0E+00
sp|Q00519|XDH_MOUSE Xanthine dehydrogenase/oxidase OS=Mus musculus GN=Xdh PE=1 SV=5 52 1397 0.0E+00
sp|O54754|AOXA_MOUSE Aldehyde oxidase 1 OS=Mus musculus GN=Aox1 PE=1 SV=2 50 1393 0.0E+00
sp|P47990|XDH_CHICK Xanthine dehydrogenase/oxidase OS=Gallus gallus GN=XDH PE=1 SV=1 52 1376 0.0E+00
sp|Q9MYW6|XDH_FELCA Xanthine dehydrogenase/oxidase OS=Felis catus GN=XDH PE=2 SV=3 52 1378 0.0E+00
sp|P47989|XDH_HUMAN Xanthine dehydrogenase/oxidase OS=Homo sapiens GN=XDH PE=1 SV=4 52 1380 0.0E+00
sp|P22985|XDH_RAT Xanthine dehydrogenase/oxidase OS=Rattus norvegicus GN=Xdh PE=1 SV=3 52 1380 0.0E+00
sp|P80457|XDH_BOVIN Xanthine dehydrogenase/oxidase OS=Bos taurus GN=XDH PE=1 SV=4 52 1380 0.0E+00
sp|P10351|XDH_DROME Xanthine dehydrogenase OS=Drosophila melanogaster GN=ry PE=2 SV=2 47 1389 0.0E+00
sp|P22811|XDH_DROPS Xanthine dehydrogenase OS=Drosophila pseudoobscura pseudoobscura GN=ry PE=3 SV=2 45 1389 0.0E+00
sp|P91711|XDH_DROSU Xanthine dehydrogenase OS=Drosophila subobscura GN=Xdh PE=3 SV=1 45 1389 0.0E+00
sp|P08793|XDH_CALVI Xanthine dehydrogenase OS=Calliphora vicina GN=XDH PE=2 SV=1 32 1377 0.0E+00
sp|Q54FB7|XDH_DICDI Xanthine dehydrogenase OS=Dictyostelium discoideum GN=xdh PE=3 SV=1 50 1383 0.0E+00
sp|Q6AUV1|XDH_ORYSJ Xanthine dehydrogenase OS=Oryza sativa subsp. japonica GN=XDH PE=2 SV=1 53 1381 0.0E+00
sp|Q8GUQ8|XDH1_ARATH Xanthine dehydrogenase 1 OS=Arabidopsis thaliana GN=XDH1 PE=1 SV=1 52 1378 0.0E+00
sp|F4JLI5|XDH2_ARATH Xanthine dehydrogenase 2 OS=Arabidopsis thaliana GN=XDH2 PE=2 SV=1 52 1378 0.0E+00
sp|P48034|AOXA_BOVIN Aldehyde oxidase 1 OS=Bos taurus GN=AOX1 PE=1 SV=2 50 1393 0.0E+00
sp|Q7G192|ALDO2_ARATH Indole-3-acetaldehyde oxidase OS=Arabidopsis thaliana GN=AAO2 PE=1 SV=2 52 1379 9.0E-176
sp|Q7G191|ALDO4_ARATH Benzaldehyde dehydrogenase (NAD(+)) OS=Arabidopsis thaliana GN=AAO4 PE=1 SV=2 52 1341 3.0E-171
sp|Q7G9P4|ALDO3_ARATH Abscisic-aldehyde oxidase OS=Arabidopsis thaliana GN=AAO3 PE=1 SV=1 50 1374 1.0E-166
sp|Q7G193|ALDO1_ARATH Indole-3-acetaldehyde oxidase OS=Arabidopsis thaliana GN=AAO1 PE=1 SV=2 52 1341 2.0E-165
sp|Q6Z351|ALDOL_ORYSJ Putative aldehyde oxidase-like protein OS=Oryza sativa subsp. japonica GN=Os07g0281700 PE=3 SV=1 90 1381 7.0E-159
sp|O23887|ALDO1_MAIZE Indole-3-acetaldehyde oxidase OS=Zea mays GN=AO1 PE=1 SV=1 48 1381 7.0E-158
sp|O23888|ALDO2_MAIZE Indole-3-acetaldehyde oxidase OS=Zea mays GN=AO2 PE=2 SV=1 54 1381 1.0E-157
sp|Q7XH05|ALDO1_ORYSJ Probable aldehyde oxidase 1 OS=Oryza sativa subsp. japonica GN=Os10g0138100 PE=2 SV=1 54 1381 1.0E-151
sp|Q852M2|ALDO3_ORYSJ Probable aldehyde oxidase 3 OS=Oryza sativa subsp. japonica GN=Os03g0790700 PE=3 SV=1 294 1381 5.0E-120
sp|Q852M1|ALDO2_ORYSJ Probable aldehyde oxidase 2 OS=Oryza sativa subsp. japonica GN=Os03g0790900 PE=2 SV=1 294 1381 1.0E-118
sp|Q69R21|ALDO4_ORYSJ Probable aldehyde oxidase 4 OS=Oryza sativa subsp. japonica GN=Os07g0282300 PE=2 SV=1 50 858 2.0E-70
sp|O32144|XDHD_BACSU Probable xanthine dehydrogenase subunit D OS=Bacillus subtilis (strain 168) GN=pucD PE=2 SV=1 634 1320 2.0E-51
sp|Q0QLF2|NDLMS_EUBBA Nicotinate dehydrogenase large molybdopterin subunit OS=Eubacterium barkeri GN=ndhL PE=1 SV=1 620 1042 9.0E-51
sp|Q46509|MOP_DESGI Aldehyde oxidoreductase OS=Desulfovibrio gigas GN=mop PE=1 SV=1 631 1263 2.0E-47
sp|Q8X6C7|XDHA_ECO57 Xanthine dehydrogenase molybdenum-binding subunit OS=Escherichia coli O157:H7 GN=xdhA PE=3 SV=1 631 1340 2.0E-45
sp|Q46799|XDHA_ECOLI Xanthine dehydrogenase molybdenum-binding subunit OS=Escherichia coli (strain K12) GN=xdhA PE=2 SV=1 631 1340 1.0E-44
sp|O33819|HCRA_THAAR 4-hydroxybenzoyl-CoA reductase subunit alpha OS=Thauera aromatica GN=hcrA PE=1 SV=1 632 1293 1.0E-43
sp|D7REY3|CDHA_PSEU3 Caffeine dehydrogenase subunit alpha OS=Pseudomonas sp. (strain CBB1) GN=cdhA PE=1 SV=1 637 1290 8.0E-43
sp|Q8XD64|XDHD_ECO57 Probable hypoxanthine oxidase XdhD OS=Escherichia coli O157:H7 GN=xdhD PE=3 SV=1 608 1301 1.0E-40
sp|Q46814|XDHD_ECOLI Probable hypoxanthine oxidase XdhD OS=Escherichia coli (strain K12) GN=xdhD PE=3 SV=1 608 1301 2.0E-39
sp|P19919|DCML_OLICO Carbon monoxide dehydrogenase large chain OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=coxL PE=1 SV=2 632 1330 9.0E-33
sp|Q933N0|KDHC_ARTNI 6-hydroxypseudooxynicotine dehydrogenase complex subunit gamma OS=Arthrobacter nicotinovorans GN=kdhC PE=1 SV=1 636 1294 4.0E-31
sp|Q4J6M3|CUTA_SULAC Glyceraldehyde dehydrogenase large chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cutA PE=1 SV=1 622 1270 7.0E-29
sp|P19913|DCML_HYDPS Carbon monoxide dehydrogenase large chain OS=Hydrogenophaga pseudoflava GN=cutL PE=1 SV=2 637 1275 7.0E-28
sp|Q4J6M5|CUTC_SULAC Glyceraldehyde dehydrogenase small chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cutC PE=1 SV=1 64 215 8.0E-27
sp|P19915|DCMS_HYDPS Carbon monoxide dehydrogenase small chain OS=Hydrogenophaga pseudoflava GN=cutS PE=1 SV=2 64 218 7.0E-26
sp|Q852M1|ALDO2_ORYSJ Probable aldehyde oxidase 2 OS=Oryza sativa subsp. japonica GN=Os03g0790900 PE=2 SV=1 54 208 2.0E-25
sp|O33818|HCRC_THAAR 4-hydroxybenzoyl-CoA reductase subunit gamma OS=Thauera aromatica GN=hcrC PE=1 SV=1 50 195 5.0E-25
sp|Q852M2|ALDO3_ORYSJ Probable aldehyde oxidase 3 OS=Oryza sativa subsp. japonica GN=Os03g0790700 PE=3 SV=1 55 208 2.0E-24
sp|Q51697|IORA_BREDI Isoquinoline 1-oxidoreductase subunit alpha OS=Brevundimonas diminuta GN=iorA PE=1 SV=1 50 198 5.0E-24
sp|Q0QLF3|NDSFS_EUBBA Nicotinate dehydrogenase small FeS subunit OS=Eubacterium barkeri GN=ndhS PE=1 SV=1 50 208 1.0E-23
sp|Q46509|MOP_DESGI Aldehyde oxidoreductase OS=Desulfovibrio gigas GN=mop PE=1 SV=1 64 201 1.0E-23
sp|Q88FX9|NICA_PSEPK Nicotinate dehydrogenase subunit A OS=Pseudomonas putida (strain KT2440) GN=nicA PE=1 SV=1 50 203 2.0E-23
sp|O32143|XDHE_BACSU Probable xanthine dehydrogenase subunit E OS=Bacillus subtilis (strain 168) GN=pucE PE=2 SV=1 51 202 4.0E-23
sp|P19921|DCMS_OLICO Carbon monoxide dehydrogenase small chain OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=coxS PE=1 SV=2 50 213 1.0E-19
sp|P77165|YAGT_ECOLI Putative xanthine dehydrogenase YagT iron-sulfur-binding subunit OS=Escherichia coli (strain K12) GN=yagT PE=1 SV=1 50 203 1.0E-18
sp|Q8X6I9|YAGT_ECO57 Putative xanthine dehydrogenase YagT iron-sulfur-binding subunit OS=Escherichia coli O157:H7 GN=yagT PE=3 SV=1 50 203 3.0E-18
sp|Q0QLF1|NDMMS_EUBBA Nicotinate dehydrogenase medium molybdopterin subunit OS=Eubacterium barkeri GN=ndhM PE=1 SV=1 1046 1337 3.0E-18
sp|Q8X6J4|YAGR_ECO57 Putative xanthine dehydrogenase YagR molybdenum-binding subunit OS=Escherichia coli O157:H7 GN=yagR PE=3 SV=1 618 1320 5.0E-18
sp|Q8X6C4|XDHC_ECO57 Xanthine dehydrogenase iron-sulfur-binding subunit OS=Escherichia coli O157:H7 GN=xdhC PE=3 SV=1 50 200 7.0E-18
sp|D7REY5|CDHC_PSEU3 Caffeine dehydrogenase subunit gamma OS=Pseudomonas sp. (strain CBB1) GN=cdhC PE=1 SV=1 50 210 2.0E-17
sp|Q46801|XDHC_ECOLI Xanthine dehydrogenase iron-sulfur-binding subunit OS=Escherichia coli (strain K12) GN=xdhC PE=3 SV=1 50 200 3.0E-17
sp|P77489|YAGR_ECOLI Putative xanthine dehydrogenase YagR molybdenum-binding subunit OS=Escherichia coli (strain K12) GN=yagR PE=3 SV=1 618 1320 4.0E-17
sp|O87682|KDHB_ARTNI 6-hydroxypseudooxynicotine dehydrogenase complex subunit beta OS=Arthrobacter nicotinovorans GN=kdhB PE=1 SV=1 63 201 4.0E-16
sp|Q0QLF4|NDFS_EUBBA Nicotinate dehydrogenase FAD-subunit OS=Eubacterium barkeri GN=ndhF PE=1 SV=1 294 587 2.0E-15
sp|Q46800|XDHB_ECOLI Xanthine dehydrogenase FAD-binding subunit OS=Escherichia coli (strain K12) GN=xdhB PE=3 SV=1 294 551 3.0E-13
sp|Q8X6C5|XDHB_ECO57 Xanthine dehydrogenase FAD-binding subunit OS=Escherichia coli O157:H7 GN=xdhB PE=3 SV=1 294 551 3.0E-13
sp|Q4J6M6|CUTB_SULAC Glyceraldehyde dehydrogenase medium chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cutB PE=1 SV=1 294 537 5.0E-11
sp|P17201|DHAQ_GLUPO Membrane-bound aldehyde dehydrogenase [pyrroloquinoline-quinone] OS=Gluconacetobacter polyoxogenes PE=1 SV=1 616 921 4.0E-10
sp|D7REY4|CDHB_PSEU3 Caffeine dehydrogenase subunit beta OS=Pseudomonas sp. (strain CBB1) GN=cdhB PE=1 SV=1 282 533 1.0E-09
sp|P19914|DCMM_HYDPS Carbon monoxide dehydrogenase medium chain OS=Hydrogenophaga pseudoflava GN=cutM PE=1 SV=2 306 535 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0046872 metal ion binding Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0051540 metal cluster binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3427
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5347 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3414
Ophiocordyceps camponoti-floridani Ophcf2|03665
Ophiocordyceps camponoti-rufipedis Ophun1|5741
Ophiocordyceps kimflemingae Ophio5|768
Ophiocordyceps subramaniannii Hirsu2|6500

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5347
MAPIAVSAAQTEAATKTTTTTTTTTTQTEPATQTEPATLAALTAQFDSCIRFYLNGTSVRLDDVDPEATVLEYLR
GIGLTGTKLGCGEGGCGACTIVVSQYNATTKAIYHASVNACLAPLASLDGKHVITIEGIGNTKRPHPTQERVARS
HGSQCGFCTPGIVMSLYALLRNNPEPSHHDIEEAFDGNLCRCTGYRPILDAAQTFGVDPSGRPSSPPASSPPASS
PPASSCCTNGAKQGCCMQNKSSDCPAQPIKRFTPPGFIQYNPDTQLIFPPALKKHQLRPLAFGNKRKRWYRPVTL
DQLLQIKSLHPQAKVIAGSTETHIEVKFKALQYPVSVYVGDIAELRHFKLGHDHVEIGGNVVLTDLEAICQEAVK
HYGPARGQVFDAMFKQLKYFAGRQIRNVGTPAGNLVTASPISDLNPVLWAAKAVLVAKSASHETEMPMDSFFVGY
RKTALPHDAVIASIRIPATAAKHEFFRAYKQAKRKDDDIAIVTAALRVKLHDNGVVQECSLIYGGMSATTVSAHT
AAKFVVGKQFADLGTLEGAMNALGSDFDLQFSVPGGMASYRKALALGFFYRFYHDVLANIQGSSQHLDKEAIGEV
ERAISTGTIDHESASAYQREVTGKPNAHLAALKQTTGEAQYTDDIPQLKNELYACWVLSTRAHAKLKSVDWSPAL
DMAGVVDYVDHGDMPSAEANKFGAPHFDEVFFAQDKVHTAGQAIGMVLATSQLRAQEAARAVKIEYEDLPAVLTI
EEAVAQDSFHPLYREIKRGNTQEAFAKCHHVFTGTVRMGGQEHFYLETNACLAVPKPEDGEMELFVSTQNANETQ
VFASRVCDVQANKVVVRVKRLGGGFGGKETRSVVLSSAVALAAKKTGRPVRCMLTREEDMVTMGQRHPFMARYKV
GVNRDGRLQALDVDVFNNAGWTFDLSASVVERAMTHCDGCYDIPNVFVRGRICRTNTMSNTAFRGFGGPQGMFIA
ESYMEEVADRLGMPVESLRQINFYKPGAMTHFNQALDDWHVPLMYEQLVCETRYGERQRAVEAFNAEHKWRKRGL
ALIPTKFGISFTALFLNQAGALVHIYHDGSVLVAHGGTEMGQGLHTKMCQIAAQALSVSLDDVFISETATNTVAN
ASPTAASASSDLNGYAVFNACELLNQRLEPYRKRLGATATMKELAHAAYFDRVNLSAQGFYKTPEIGYTWGENKG
KMFFYFTQGVAAAEVEVDTLTGSWTCTRADIKMDVGQSINPAIDYGQIQGAFVQGMGLFTMEESLWLRNGPAAGN
LFTRGPGAYKIPGFRDVPQEFGVTLLKDVEWKQLRTIQRSRGVGEPPLFLGSAVFFAIRHALRAARAANGVKAEV
GVDEGEGLLRLESPATAERIRLACEDEIVTRARVVPRQGEKSFFVAI*
Coding >OphauG2|5347
ATGGCGCCCATTGCTGTGTCGGCGGCGCAGACAGAGGCGGCAACGAAAACGACGACGACGACGACGACGACGACG
ACGCAGACAGAGCCTGCGACGCAGACAGAGCCCGCGACGCTGGCGGCGCTGACGGCCCAGTTTGACAGTTGCATC
CGCTTCTACCTCAACGGCACAAGCGTGCGGCTCGACGACGTCGACCCCGAGGCCACGGTGCTCGAGTATCTGCGA
GGCATTGGCCTGACGGGCACCAAGCTTGGCTGTGGCGAAGGCGGGTGCGGCGCCTGCACCATTGTCGTCAGCCAG
TACAATGCCACCACAAAGGCCATCTACCATGCCAGTGTCAATGCCTGCCTGGCGCCGCTGGCCAGCCTCGACGGC
AAACACGTCATTACCATTGAAGGCATCGGCAACACCAAGCGGCCGCATCCAACACAGGAGCGCGTGGCCCGCAGC
CACGGCAGCCAGTGCGGCTTCTGCACCCCGGGCATTGTCATGAGCCTGTACGCGCTGCTCCGCAACAATCCCGAG
CCGTCGCACCACGACATTGAAGAGGCCTTTGACGGCAACCTGTGCCGCTGCACCGGCTACAGGCCCATTCTCGAC
GCGGCACAGACATTTGGCGTCGACCCTAGTGGCCGGCCGTCCTCCCCTCCAGCATCCTCTCCTCCAGCATCCTCC
CCTCCAGCATCCTCTTGCTGCACCAATGGCGCCAAACAGGGCTGCTGTATGCAAAACAAGAGCTCAGACTGTCCG
GCCCAGCCCATCAAGCGCTTCACCCCCCCGGGCTTCATCCAGTACAACCCCGACACCCAACTCATCTTTCCTCCC
GCCCTCAAGAAGCACCAGCTCCGCCCGCTGGCCTTTGGCAACAAGCGCAAGCGCTGGTACCGCCCCGTCACCCTG
GACCAGCTGCTCCAGATCAAGAGCCTGCATCCTCAGGCAAAGGTGATTGCCGGCAGTACCGAGACGCACATTGAA
GTCAAATTCAAGGCGCTGCAGTACCCCGTGTCTGTCTACGTCGGCGACATTGCAGAGTTGCGCCACTTCAAGCTC
GGCCACGACCACGTAGAGATTGGCGGCAATGTGGTCCTGACGGATCTCGAGGCCATCTGCCAAGAAGCCGTCAAG
CATTACGGGCCCGCACGCGGACAGGTCTTTGACGCCATGTTCAAGCAGCTCAAGTACTTTGCAGGAAGACAGATT
CGCAACGTCGGCACCCCTGCCGGTAACCTGGTGACCGCCTCGCCCATTTCCGACTTGAACCCGGTGCTGTGGGCT
GCCAAGGCGGTCCTTGTGGCCAAGTCGGCCTCTCACGAGACCGAGATGCCCATGGACAGCTTCTTTGTTGGCTAC
CGCAAGACGGCTCTGCCGCACGATGCAGTCATTGCCTCGATTCGCATCCCAGCCACAGCCGCCAAGCACGAGTTT
TTCCGCGCCTACAAACAGGCCAAACGCAAGGATGATGACATTGCCATTGTCACGGCCGCGCTAAGAGTCAAGCTG
CACGACAATGGCGTGGTGCAAGAGTGCAGTCTCATATACGGAGGCATGTCGGCCACGACGGTGTCGGCCCACACG
GCGGCCAAGTTTGTAGTGGGCAAGCAATTTGCTGACCTGGGCACCCTCGAGGGCGCCATGAATGCCCTGGGCAGT
GATTTTGACTTGCAGTTTAGTGTTCCCGGCGGCATGGCCTCGTACCGCAAGGCTCTCGCGCTTGGCTTCTTTTAT
CGCTTCTACCACGACGTCTTGGCAAACATTCAAGGCAGCAGCCAGCATCTCGACAAGGAGGCCATTGGCGAGGTG
GAGAGAGCCATTTCTACCGGCACCATTGACCATGAGTCGGCCTCGGCCTACCAACGCGAGGTGACGGGCAAGCCC
AACGCCCACCTCGCGGCGCTCAAGCAGACGACGGGCGAGGCACAGTACACAGACGACATTCCGCAGCTCAAGAAT
GAATTATACGCCTGCTGGGTGCTCTCAACACGGGCGCACGCAAAGCTCAAGTCGGTCGACTGGTCGCCGGCGCTT
GACATGGCTGGTGTGGTTGACTATGTTGACCACGGCGACATGCCCTCGGCCGAAGCCAACAAGTTTGGCGCGCCT
CACTTTGACGAAGTCTTTTTTGCCCAAGACAAAGTGCACACTGCCGGCCAGGCCATTGGCATGGTCTTGGCCACG
TCGCAGCTGCGGGCCCAAGAGGCAGCCAGGGCGGTCAAGATTGAGTACGAGGACTTGCCAGCGGTGCTGACCATT
GAAGAGGCCGTGGCCCAAGACAGTTTCCACCCGCTGTACCGCGAGATCAAGAGAGGCAACACGCAAGAGGCCTTT
GCCAAGTGCCACCACGTCTTTACGGGCACGGTGCGCATGGGCGGCCAGGAGCATTTTTACCTCGAGACGAATGCC
TGCTTGGCTGTGCCCAAGCCCGAGGACGGCGAGATGGAGTTGTTTGTGAGCACGCAGAATGCGAATGAGACTCAA
GTCTTTGCCTCGCGCGTGTGCGACGTGCAGGCCAACAAGGTTGTCGTGCGAGTCAAGCGGCTGGGCGGGGGCTTT
GGCGGCAAAGAGACGCGGTCCGTGGTGCTCAGCTCGGCGGTAGCGCTGGCAGCAAAGAAGACGGGCAGGCCGGTG
CGGTGCATGCTGACGCGCGAAGAAGACATGGTGACCATGGGCCAGCGGCATCCCTTCATGGCGCGGTACAAGGTG
GGCGTCAATCGCGACGGCAGGCTCCAGGCGCTAGACGTGGACGTGTTCAACAATGCCGGGTGGACCTTTGACCTC
AGCGCGAGCGTCGTTGAGCGGGCCATGACGCACTGCGACGGCTGCTACGACATCCCCAATGTCTTTGTGCGCGGC
CGCATCTGCCGGACAAACACCATGTCCAACACGGCCTTCCGCGGCTTCGGCGGGCCGCAGGGCATGTTTATTGCC
GAGTCGTACATGGAGGAGGTGGCCGACCGGCTGGGCATGCCCGTCGAGAGCCTGCGGCAAATCAACTTTTACAAG
CCCGGCGCCATGACCCACTTCAACCAGGCGCTGGACGACTGGCACGTGCCGCTCATGTACGAGCAGCTTGTTTGC
GAGACGCGATATGGCGAGCGGCAAAGGGCCGTGGAAGCCTTCAACGCCGAGCACAAGTGGCGCAAACGGGGGCTG
GCCTTGATCCCCACCAAGTTTGGCATTTCCTTTACCGCTCTCTTCCTCAACCAAGCCGGCGCCTTGGTCCACATC
TACCACGATGGATCCGTCCTTGTCGCCCACGGCGGCACCGAGATGGGCCAGGGCCTTCACACAAAGATGTGCCAG
ATTGCCGCACAAGCCCTCTCTGTGTCGCTCGACGACGTCTTCATCTCGGAGACGGCGACAAACACCGTGGCCAAT
GCGTCGCCAACCGCCGCCTCGGCCTCTTCAGACCTCAATGGCTATGCCGTCTTCAACGCCTGCGAGCTGCTCAAC
CAGAGACTCGAGCCATATCGCAAGCGTCTGGGTGCAACGGCCACCATGAAGGAGCTGGCTCACGCCGCCTACTTT
GACCGCGTCAACCTGTCTGCCCAGGGCTTCTACAAGACGCCCGAGATTGGCTACACGTGGGGCGAGAACAAGGGC
AAGATGTTCTTCTACTTTACCCAGGGCGTGGCGGCAGCCGAGGTTGAAGTGGACACGCTGACGGGCTCGTGGACG
TGTACGCGAGCCGACATCAAGATGGACGTTGGCCAATCCATCAACCCAGCCATTGATTACGGCCAGATCCAAGGT
GCCTTTGTGCAAGGCATGGGTCTCTTCACCATGGAGGAGTCGCTGTGGCTGCGCAACGGGCCAGCTGCAGGCAAT
CTCTTTACGCGCGGGCCCGGCGCCTACAAGATTCCTGGCTTTCGCGACGTGCCTCAAGAGTTTGGCGTGACACTG
CTCAAGGACGTTGAGTGGAAGCAACTGCGTACCATTCAGCGAAGCCGAGGGGTGGGAGAGCCACCTCTGTTCCTG
GGTAGCGCCGTCTTCTTTGCCATTCGCCATGCTCTGCGGGCGGCTAGGGCAGCCAATGGCGTCAAGGCCGAGGTT
GGTGTTGACGAGGGTGAAGGCTTGTTGAGGTTGGAGAGCCCAGCAACAGCCGAGCGAATCCGGCTAGCCTGTGAG
GACGAGATTGTGACGAGGGCAAGGGTCGTGCCTCGACAAGGCGAGAAGAGTTTTTTTGTGGCCATTTAG
Transcript >OphauG2|5347
ATGGCGCCCATTGCTGTGTCGGCGGCGCAGACAGAGGCGGCAACGAAAACGACGACGACGACGACGACGACGACG
ACGCAGACAGAGCCTGCGACGCAGACAGAGCCCGCGACGCTGGCGGCGCTGACGGCCCAGTTTGACAGTTGCATC
CGCTTCTACCTCAACGGCACAAGCGTGCGGCTCGACGACGTCGACCCCGAGGCCACGGTGCTCGAGTATCTGCGA
GGCATTGGCCTGACGGGCACCAAGCTTGGCTGTGGCGAAGGCGGGTGCGGCGCCTGCACCATTGTCGTCAGCCAG
TACAATGCCACCACAAAGGCCATCTACCATGCCAGTGTCAATGCCTGCCTGGCGCCGCTGGCCAGCCTCGACGGC
AAACACGTCATTACCATTGAAGGCATCGGCAACACCAAGCGGCCGCATCCAACACAGGAGCGCGTGGCCCGCAGC
CACGGCAGCCAGTGCGGCTTCTGCACCCCGGGCATTGTCATGAGCCTGTACGCGCTGCTCCGCAACAATCCCGAG
CCGTCGCACCACGACATTGAAGAGGCCTTTGACGGCAACCTGTGCCGCTGCACCGGCTACAGGCCCATTCTCGAC
GCGGCACAGACATTTGGCGTCGACCCTAGTGGCCGGCCGTCCTCCCCTCCAGCATCCTCTCCTCCAGCATCCTCC
CCTCCAGCATCCTCTTGCTGCACCAATGGCGCCAAACAGGGCTGCTGTATGCAAAACAAGAGCTCAGACTGTCCG
GCCCAGCCCATCAAGCGCTTCACCCCCCCGGGCTTCATCCAGTACAACCCCGACACCCAACTCATCTTTCCTCCC
GCCCTCAAGAAGCACCAGCTCCGCCCGCTGGCCTTTGGCAACAAGCGCAAGCGCTGGTACCGCCCCGTCACCCTG
GACCAGCTGCTCCAGATCAAGAGCCTGCATCCTCAGGCAAAGGTGATTGCCGGCAGTACCGAGACGCACATTGAA
GTCAAATTCAAGGCGCTGCAGTACCCCGTGTCTGTCTACGTCGGCGACATTGCAGAGTTGCGCCACTTCAAGCTC
GGCCACGACCACGTAGAGATTGGCGGCAATGTGGTCCTGACGGATCTCGAGGCCATCTGCCAAGAAGCCGTCAAG
CATTACGGGCCCGCACGCGGACAGGTCTTTGACGCCATGTTCAAGCAGCTCAAGTACTTTGCAGGAAGACAGATT
CGCAACGTCGGCACCCCTGCCGGTAACCTGGTGACCGCCTCGCCCATTTCCGACTTGAACCCGGTGCTGTGGGCT
GCCAAGGCGGTCCTTGTGGCCAAGTCGGCCTCTCACGAGACCGAGATGCCCATGGACAGCTTCTTTGTTGGCTAC
CGCAAGACGGCTCTGCCGCACGATGCAGTCATTGCCTCGATTCGCATCCCAGCCACAGCCGCCAAGCACGAGTTT
TTCCGCGCCTACAAACAGGCCAAACGCAAGGATGATGACATTGCCATTGTCACGGCCGCGCTAAGAGTCAAGCTG
CACGACAATGGCGTGGTGCAAGAGTGCAGTCTCATATACGGAGGCATGTCGGCCACGACGGTGTCGGCCCACACG
GCGGCCAAGTTTGTAGTGGGCAAGCAATTTGCTGACCTGGGCACCCTCGAGGGCGCCATGAATGCCCTGGGCAGT
GATTTTGACTTGCAGTTTAGTGTTCCCGGCGGCATGGCCTCGTACCGCAAGGCTCTCGCGCTTGGCTTCTTTTAT
CGCTTCTACCACGACGTCTTGGCAAACATTCAAGGCAGCAGCCAGCATCTCGACAAGGAGGCCATTGGCGAGGTG
GAGAGAGCCATTTCTACCGGCACCATTGACCATGAGTCGGCCTCGGCCTACCAACGCGAGGTGACGGGCAAGCCC
AACGCCCACCTCGCGGCGCTCAAGCAGACGACGGGCGAGGCACAGTACACAGACGACATTCCGCAGCTCAAGAAT
GAATTATACGCCTGCTGGGTGCTCTCAACACGGGCGCACGCAAAGCTCAAGTCGGTCGACTGGTCGCCGGCGCTT
GACATGGCTGGTGTGGTTGACTATGTTGACCACGGCGACATGCCCTCGGCCGAAGCCAACAAGTTTGGCGCGCCT
CACTTTGACGAAGTCTTTTTTGCCCAAGACAAAGTGCACACTGCCGGCCAGGCCATTGGCATGGTCTTGGCCACG
TCGCAGCTGCGGGCCCAAGAGGCAGCCAGGGCGGTCAAGATTGAGTACGAGGACTTGCCAGCGGTGCTGACCATT
GAAGAGGCCGTGGCCCAAGACAGTTTCCACCCGCTGTACCGCGAGATCAAGAGAGGCAACACGCAAGAGGCCTTT
GCCAAGTGCCACCACGTCTTTACGGGCACGGTGCGCATGGGCGGCCAGGAGCATTTTTACCTCGAGACGAATGCC
TGCTTGGCTGTGCCCAAGCCCGAGGACGGCGAGATGGAGTTGTTTGTGAGCACGCAGAATGCGAATGAGACTCAA
GTCTTTGCCTCGCGCGTGTGCGACGTGCAGGCCAACAAGGTTGTCGTGCGAGTCAAGCGGCTGGGCGGGGGCTTT
GGCGGCAAAGAGACGCGGTCCGTGGTGCTCAGCTCGGCGGTAGCGCTGGCAGCAAAGAAGACGGGCAGGCCGGTG
CGGTGCATGCTGACGCGCGAAGAAGACATGGTGACCATGGGCCAGCGGCATCCCTTCATGGCGCGGTACAAGGTG
GGCGTCAATCGCGACGGCAGGCTCCAGGCGCTAGACGTGGACGTGTTCAACAATGCCGGGTGGACCTTTGACCTC
AGCGCGAGCGTCGTTGAGCGGGCCATGACGCACTGCGACGGCTGCTACGACATCCCCAATGTCTTTGTGCGCGGC
CGCATCTGCCGGACAAACACCATGTCCAACACGGCCTTCCGCGGCTTCGGCGGGCCGCAGGGCATGTTTATTGCC
GAGTCGTACATGGAGGAGGTGGCCGACCGGCTGGGCATGCCCGTCGAGAGCCTGCGGCAAATCAACTTTTACAAG
CCCGGCGCCATGACCCACTTCAACCAGGCGCTGGACGACTGGCACGTGCCGCTCATGTACGAGCAGCTTGTTTGC
GAGACGCGATATGGCGAGCGGCAAAGGGCCGTGGAAGCCTTCAACGCCGAGCACAAGTGGCGCAAACGGGGGCTG
GCCTTGATCCCCACCAAGTTTGGCATTTCCTTTACCGCTCTCTTCCTCAACCAAGCCGGCGCCTTGGTCCACATC
TACCACGATGGATCCGTCCTTGTCGCCCACGGCGGCACCGAGATGGGCCAGGGCCTTCACACAAAGATGTGCCAG
ATTGCCGCACAAGCCCTCTCTGTGTCGCTCGACGACGTCTTCATCTCGGAGACGGCGACAAACACCGTGGCCAAT
GCGTCGCCAACCGCCGCCTCGGCCTCTTCAGACCTCAATGGCTATGCCGTCTTCAACGCCTGCGAGCTGCTCAAC
CAGAGACTCGAGCCATATCGCAAGCGTCTGGGTGCAACGGCCACCATGAAGGAGCTGGCTCACGCCGCCTACTTT
GACCGCGTCAACCTGTCTGCCCAGGGCTTCTACAAGACGCCCGAGATTGGCTACACGTGGGGCGAGAACAAGGGC
AAGATGTTCTTCTACTTTACCCAGGGCGTGGCGGCAGCCGAGGTTGAAGTGGACACGCTGACGGGCTCGTGGACG
TGTACGCGAGCCGACATCAAGATGGACGTTGGCCAATCCATCAACCCAGCCATTGATTACGGCCAGATCCAAGGT
GCCTTTGTGCAAGGCATGGGTCTCTTCACCATGGAGGAGTCGCTGTGGCTGCGCAACGGGCCAGCTGCAGGCAAT
CTCTTTACGCGCGGGCCCGGCGCCTACAAGATTCCTGGCTTTCGCGACGTGCCTCAAGAGTTTGGCGTGACACTG
CTCAAGGACGTTGAGTGGAAGCAACTGCGTACCATTCAGCGAAGCCGAGGGGTGGGAGAGCCACCTCTGTTCCTG
GGTAGCGCCGTCTTCTTTGCCATTCGCCATGCTCTGCGGGCGGCTAGGGCAGCCAATGGCGTCAAGGCCGAGGTT
GGTGTTGACGAGGGTGAAGGCTTGTTGAGGTTGGAGAGCCCAGCAACAGCCGAGCGAATCCGGCTAGCCTGTGAG
GACGAGATTGTGACGAGGGCAAGGGTCGTGCCTCGACAAGGCGAGAAGAGTTTTTTTGTGGCCATTTAG
Gene >OphauG2|5347
ATGGCGCCCATTGCTGTGTCGGCGGCGCAGACAGAGGCGGCAACGAAAACGACGACGACGACGACGACGACGACG
ACGCAGACAGAGCCTGCGACGCAGACAGAGCCCGCGACGCTGGCGGCGCTGACGGCCCAGTTTGACAGTTGCATC
CGCTTCTACCTCAACGGCACAAGCGTGCGGCTCGACGACGTCGACCCCGAGGCCACGGTGCTCGAGTATCTGCGA
GGCATTGGCCTGACGGGCACCAAGCTGTAAGCAAGACGCCGACTACACACACACACACAAGTGCATCTGGCGCTG
ACTCTCAGACGACGGCAGTGGCTGTGGCGAAGGCGGGTGCGGCGCCTGCACCATTGTCGTCAGCCAGTACAATGC
CACCACAAAGGCCATCTACCATGCCAGTGTCAATGCCTGCCTGGCGCCGCTGGCCAGCCTCGACGGCAAACACGT
CATTACCATTGAAGGCATCGGCAACACCAAGCGGCCGCATCCAACACAGGAGCGCGTGGCCCGCAGCCACGGCAG
CCAGTGCGGCTTCTGCACCCCGGGCATTGTCATGAGCCTGTACGCGCTGCTCCGCAACAATCCCGAGCCGTCGCA
CCACGACATTGAAGAGGCCTTTGACGGCAACCTGTGCCGCTGCACCGGCTACAGGCCCATTCTCGACGCGGCACA
GACATTTGGCGTCGACCCTAGTGGCCGGCCGTCCTCCCCTCCAGCATCCTCTCCTCCAGCATCCTCCCCTCCAGC
ATCCTCTTGCTGCACCAATGGCGCCAAACAGGGCTGCTGTATGCAAAACAAGAGCTCAGACTGTCCGGCCCAGCC
CATCAAGCGCTTCACCCCCCCGGGCTTCATCCAGTACAACCCCGACACCCAACTCATCTTTCCTCCCGCCCTCAA
GAAGCACCAGCTCCGCCCGCTGGCCTTTGGCAACAAGCGCAAGCGCTGGTACCGCCCCGTCACCCTGGACCAGCT
GCTCCAGATCAAGAGCCTGCATCCTCAGGCAAAGGTGATTGCCGGCAGTACCGAGACGCACATTGAAGTCAAATT
CAAGGCGCTGCAGTACCCCGTGTCTGTCTACGTCGGCGACATTGCAGAGTTGCGCCACTTCAAGCTCGGCCACGA
CCACGTAGAGATTGGCGGCAATGTGGTCCTGACGGATCTCGAGGCCATCTGCCAAGAAGCCGTCAAGCATTACGG
GCCCGCACGCGGACAGGTCTTTGACGCCATGTTCAAGCAGCTCAAGTACTTTGCAGGAAGACAGATTCGCAACGT
CGGCACCCCTGCCGGTAACCTGGTGACCGCCTCGCCCATTTCCGACTTGAACCCGGTGCTGTGGGCTGCCAAGGC
GGTCCTTGTGGCCAAGTCGGCCTCTCACGAGACCGAGATGCCCATGGACAGCTTCTTTGTTGGCTACCGCAAGAC
GGCTCTGCCGCACGATGCAGTCATTGCCTCGATTCGCATCCCAGCCACAGCCGCCAAGCACGAGTTTTTCCGCGC
CTACAAACAGGCCAAACGCAAGGATGATGACATTGCCATTGTCACGGCCGCGCTAAGAGTCAAGCTGCACGACAA
TGGCGTGGTGCAAGAGTGCAGTCTCATATACGGAGGCATGTCGGCCACGACGGTGTCGGCCCACACGGCGGCCAA
GTTTGTAGTGGGCAAGCAATTTGCTGACCTGGGCACCCTCGAGGGCGCCATGAATGCCCTGGGCAGTGATTTTGA
CTTGCAGTTTAGTGTTCCCGGCGGCATGGCCTCGTACCGCAAGGCTCTCGCGCTTGGCTTCTTTTATCGCTTCTA
CCACGACGTCTTGGCAAACATTCAAGGCAGCAGCCAGCATCTCGACAAGGAGGCCATTGGCGAGGTGGAGAGAGC
CATTTCTACCGGCACCATTGACCATGAGTCGGCCTCGGCCTACCAACGCGAGGTGACGGGCAAGCCCAACGCCCA
CCTCGCGGCGCTCAAGCAGACGACGGGCGAGGCACAGTACACAGACGACATTCCGCAGCTCAAGAATGAATTATA
CGCCTGCTGGGTGCTCTCAACACGGGCGCACGCAAAGCTCAAGTCGGTCGACTGGTCGCCGGCGCTTGACATGGC
TGGTGTGGTTGACTATGTTGACCACGGCGACATGCCCTCGGCCGAAGCCAACAAGTTTGGCGCGCCTCACTTTGA
CGAAGTCTTTTTTGCCCAAGACAAAGTGCACACTGCCGGCCAGGCCATTGGCATGGTCTTGGCCACGTCGCAGCT
GCGGGCCCAAGAGGCAGCCAGGGCGGTCAAGATTGAGTACGAGGACTTGCCAGCGGTGCTGACCATTGAAGAGGC
CGTGGCCCAAGACAGTTTCCACCCGCTGTACCGCGAGATCAAGAGAGGCAACACGCAAGAGGCCTTTGCCAAGTG
CCACCACGTCTTTACGGGCACGGTGCGCATGGGCGGCCAGGAGCATTTTTACCTCGAGACGAATGCCTGCTTGGC
TGTGCCCAAGCCCGAGGACGGCGAGATGGAGTTGTTTGTGAGCACGCAGAATGCGAATGAGACGTGAGACACACA
CAAATCTTGTACGCCACAAGCCATGGATGAATGCTGACGGGCCAAACACAGTCAAGTCTTTGCCTCGCGCGTGTG
CGACGTGCAGGCCAACAAGGTTGTCGTGCGAGTCAAGCGGCTGGGCGGGGGCTTTGGCGGCAAAGAGACGCGGTC
CGTGGTGCTCAGCTCGGCGGTAGCGCTGGCAGCAAAGAAGACGGGCAGGCCGGTGCGGTGCATGCTGACGCGCGA
AGAAGACATGGTGACCATGGGCCAGCGGCATCCCTTCATGGCGCGGTACAAGGTGGGCGTCAATCGCGACGGCAG
GCTCCAGGCGCTAGACGTGGACGTGTTCAACAATGCCGGGTGGACCTTTGACCTCAGCGCGAGCGTCGTTGAGCG
GGCCATGACGCACTGCGACGGCTGCTACGACATCCCCAATGTCTTTGTGCGCGGCCGCATCTGCCGGACAAACAC
CATGTCCAACACGGCCTTCCGCGGCTTCGGCGGGCCGCAGGGCATGTTTATTGCCGAGTCGTACATGGAGGAGGT
GGCCGACCGGCTGGGCATGCCCGTCGAGAGCCTGCGGCAAATCAACTTTTACAAGCCCGGCGCCATGACCCACTT
CAACCAGGCGCTGGACGACTGGCACGTGCCGCTCATGTACGAGCAGCTTGTTTGCGAGACGCGATATGGCGAGCG
GCAAAGGGCCGTGGAAGCCTTCAACGCCGAGCACAAGTGGCGCAAACGGGGGCTGGCCTTGATCCCCACCAAGTT
TGGCATTTCCTTTACCGCTCTCTTCCTCAACCAAGCCGGCGCCTTGGTCCACATCTACCACGATGGATCCGTCCT
TGTCGCCCACGGCGGCACCGAGATGGGCCAGGGCCTTCACACAAAGATGTGCCAGATTGCCGCACAAGCCCTCTC
TGTGTCGCTCGACGACGTCTTCATCTCGGAGACGGCGACAAACACCGTGGCCAATGCGTCGCCAACCGCCGCCTC
GGCCTCTTCAGACCTCAATGGCTATGCCGTCTTCAACGCCTGCGAGCTGCTCAACCAGAGACTCGAGCCATATCG
CAAGCGTCTGGGTGCAACGGCCACCATGAAGGAGCTGGCTCACGCCGCCTACTTTGACCGCGTCAACCTGTCTGC
CCAGGGCTTCTACAAGACGCCCGAGATTGGCTACACGTGGGGCGAGAACAAGGGCAAGATGTTCTTCTACTTTAC
CCAGGGCGTGGCGGCAGCCGAGGTTGAAGTGGACACGCTGACGGGCTCGTGGACGTGTACGCGAGCCGACATCAA
GATGGACGTTGGCCAATCCATCAACCCAGCCATTGATTACGGCCAGATCCAAGGTGCCTTTGTGCAAGGCATGGG
TCTCTTCACCATGGAGGAGTCGCTGTGGCTGCGCAACGGGCCAGCTGCAGGCAATCTCTTTACGCGCGGGCCCGG
CGCCTACAAGATTCCTGGCTTTCGCGACGTGCCTCAAGAGTTTGGCGTGACACTGCTCAAGGACGTTGAGTGGAA
GCAACTGCGTACCATTCAGCGAAGCCGAGGGGTGGGAGAGCCACCTCTGTTCCTGGGTAGCGCCGTCTTCTTTGC
CATTCGCCATGCTCTGCGGGCGGCTAGGGCAGCCAATGGCGTCAAGGCCGAGGTTGGTGTTGACGAGGGTGAAGG
CTTGTTGAGGTTGGAGAGCCCAGCAACAGCCGAGCGAATCCGGCTAGCCTGTGAGGACGAGATTGTGACGAGGGC
AAGGGTCGTGCCTCGACAAGGCGAGAAGAGTTTTTTTGTGGCCATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail