Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5335
Gene name
LocationContig_487:153..4614
Strand-
Gene length (bp)4461
Transcript length (bp)3783
Coding sequence length (bp)3783
Protein length (aa) 1261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 3.6E-17 98 263
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 1.9E-34 268 364
PF00136 DNA_pol_B DNA polymerase family B 2.1E-13 668 1014

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WXH8|DPOE_ASPFU DNA polymerase epsilon catalytic subunit A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pol2 PE=3 SV=1 15 1055 0.0E+00
sp|Q54RD4|DPOE1_DICDI DNA polymerase epsilon catalytic subunit A OS=Dictyostelium discoideum GN=pole PE=3 SV=1 55 1053 0.0E+00
sp|F4IFN6|DPOE2_ARATH DNA polymerase epsilon catalytic subunit B OS=Arabidopsis thaliana GN=POL2B PE=2 SV=1 46 1257 0.0E+00
sp|F4HW04|DPOE1_ARATH DNA polymerase epsilon catalytic subunit A OS=Arabidopsis thaliana GN=POL2A PE=1 SV=1 54 1257 0.0E+00
sp|Q9WVF7|DPOE1_MOUSE DNA polymerase epsilon catalytic subunit A OS=Mus musculus GN=Pole PE=1 SV=3 36 1252 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WXH8|DPOE_ASPFU DNA polymerase epsilon catalytic subunit A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pol2 PE=3 SV=1 15 1055 0.0E+00
sp|Q54RD4|DPOE1_DICDI DNA polymerase epsilon catalytic subunit A OS=Dictyostelium discoideum GN=pole PE=3 SV=1 55 1053 0.0E+00
sp|F4IFN6|DPOE2_ARATH DNA polymerase epsilon catalytic subunit B OS=Arabidopsis thaliana GN=POL2B PE=2 SV=1 46 1257 0.0E+00
sp|F4HW04|DPOE1_ARATH DNA polymerase epsilon catalytic subunit A OS=Arabidopsis thaliana GN=POL2A PE=1 SV=1 54 1257 0.0E+00
sp|Q9WVF7|DPOE1_MOUSE DNA polymerase epsilon catalytic subunit A OS=Mus musculus GN=Pole PE=1 SV=3 36 1252 0.0E+00
sp|Q07864|DPOE1_HUMAN DNA polymerase epsilon catalytic subunit A OS=Homo sapiens GN=POLE PE=1 SV=5 12 1252 0.0E+00
sp|P21951|DPOE_YEAST DNA polymerase epsilon catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL2 PE=1 SV=1 54 1259 0.0E+00
sp|Q752B8|DPOE_ASHGO DNA polymerase epsilon catalytic subunit A OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=POL2 PE=3 SV=2 15 1255 0.0E+00
sp|Q6CUS7|DPOE_KLULA DNA polymerase epsilon catalytic subunit A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=POL2 PE=3 SV=1 15 1256 0.0E+00
sp|Q6FNY7|DPOE_CANGA DNA polymerase epsilon catalytic subunit A OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=POL2 PE=3 SV=1 54 1257 0.0E+00
sp|P87154|DPOE_SCHPO DNA polymerase epsilon catalytic subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol2 PE=2 SV=1 1 1255 0.0E+00
sp|P0CN27|DPOE_CRYNB DNA polymerase epsilon catalytic subunit A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=POL2 PE=3 SV=1 25 1252 0.0E+00
sp|P0CN26|DPOE_CRYNJ DNA polymerase epsilon catalytic subunit A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=POL2 PE=3 SV=1 25 1252 0.0E+00
sp|Q4PFV5|DPOE_USTMA DNA polymerase epsilon catalytic subunit A OS=Ustilago maydis (strain 521 / FGSC 9021) GN=POL2 PE=3 SV=1 1 1255 0.0E+00
sp|Q6BNG2|DPOE_DEBHA DNA polymerase epsilon catalytic subunit A OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=POL2 PE=3 SV=2 43 1256 0.0E+00
sp|O93845|DPOE_EMENI DNA polymerase epsilon catalytic subunit A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pol2 PE=3 SV=2 7 1257 0.0E+00
sp|Q6C4J0|DPOE_YARLI DNA polymerase epsilon catalytic subunit A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=POL2 PE=3 SV=1 43 580 2.0E-153
sp|Q6C4J0|DPOE_YARLI DNA polymerase epsilon catalytic subunit A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=POL2 PE=3 SV=1 610 1208 1.0E-151
sp|Q4WXH8|DPOE_ASPFU DNA polymerase epsilon catalytic subunit A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pol2 PE=3 SV=1 1151 1257 1.0E-21
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 236 488 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4864
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5335 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6603
Ophiocordyceps camponoti-floridani Ophcf2|05211
Ophiocordyceps kimflemingae Ophio5|4721
Ophiocordyceps subramaniannii Hirsu2|11038

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5335
MPNTSLRRPEKGVRRGGKTAYHGGRPQRVFAATARAEGTSAEEKWERVKLAQTIDEDMGFARYSSGKRRQGWLVN
VQPASVEDERNIGGRAALDCYFIQEDSSTFKATIEYEPYFLVAVKRGRELEAEEWIKRVPGDGVVKSVRRIEKDD
LSLPNHLLGHRRTLLELRFSNVRDLMAARNDLLPVAEKNKKNMNAVEAYAQVVASDANMDLFDDDVNEDERRSNK
PLADASDYIVDIREYDVPYHVRVMIDLDIRVGKWYFVEAKHGLPLKFPDAAIDQVMMISYMIDGQGFLITNREII
SEDIGDFEYTPKPEYPGCFMIFNEPNEKALLERFLVHVKEARPTVIATYNGDFFDWPFVEARASFHGIDLYTETG
WKKDNDDQFKWSRGLKAVTVAKLGYDPDELDPELMLPYASERPQTLAEYSVSDAVATYYLYMKYGTGTLCEMLLM
APKEAFWEGHLLDSETYVGGHVESIEAGVFRSDIAVDFAVDAGAVDELLRDLDAALEFVLTVEEKQSLDDVDNLA
EVKQQIVDRLMKLKETPNRHEQPLIYHLDPDSMISESDCAACDFNRPGKTCDRRLPALESEKFAGKHAKAPMRPF
QDLPADEQASLVREAIICQRENPFYINTVRDFRDRRYDYKGQAKVWKGKAEALKSQGGTGSEIEAANKMVVVYDS
LQLAHKVILNSFYGYVMRKGSRWYSMEMAGVTCLTGATIIQMARQLVERLGRPLELDTDGIWCMLPATFPENFCF
RLKNGKRVNISYPCVMLNHLVHARFTNHQYQTLVDGKTFRYETHSDNSIFFEVDGPYKAMVLPTSKEEDKNLKKR
YAVFNHDGTLAELKGFELKRRGELKLIKIFQQQIFGFFLQGSNLGECYGAVAKVANRWLDVLHNKGTTLADEELM
DLISENRSMSKTLQEYGTQKSTSITTARRLADFLGEQMVKDKGLNCKFIICAKPRNAPVTERAVPVAIFSADEAT
KRAFLKKWLKEEPAKTDPRALVDWDYYLERLGSVIQKLITIPAALQRLRNPVPRVAHPDWLQKRINTKDDRMKQK
KLTDMAKVRVGRADDMEDFGSRLLRPKAVEVALASSQASSQASXXXXXXXXXXXXXXRRRRRRSGTRHGRPPCNG
AGPVSRLRCLFGLFGQTKQTGPGGGGNSNIEHRFQKQAHATFMKPWQLLQIKPSTKAGEVRAHVLIDKRIHSVKL
VVPRQVYVNIKSGSAMPDVDIAGCEVEQVNSTLPSGQGSSRLFKLTVAESVYSSEAEACR*
Coding >OphauG2|5335
ATGCCCAACACCAGTCTACGTCGCCCGGAAAAGGGCGTTCGCCGTGGAGGCAAAACCGCGTACCACGGCGGACGG
CCGCAGCGCGTGTTTGCCGCTACAGCGCGGGCCGAGGGCACGTCGGCCGAGGAGAAATGGGAGCGGGTCAAGCTG
GCGCAAACAATTGACGAGGACATGGGCTTTGCGCGCTATTCCAGTGGCAAGCGCAGACAAGGATGGCTAGTCAAT
GTGCAGCCGGCATCTGTTGAAGATGAGAGAAACATTGGCGGCCGGGCGGCGCTGGATTGCTACTTTATCCAGGAG
GATAGCTCGACCTTCAAGGCAACGATTGAATACGAGCCTTACTTTCTTGTGGCTGTCAAGCGAGGTCGAGAGTTG
GAGGCCGAGGAATGGATCAAGCGGGTGCCAGGCGACGGCGTGGTCAAGTCGGTTCGCAGAATTGAAAAGGACGAT
TTGAGTCTGCCCAACCACTTGCTGGGCCATCGGCGAACTTTGCTTGAGCTTCGCTTTTCCAACGTTCGGGATCTC
ATGGCTGCGAGGAACGACTTGCTGCCTGTGGCGGAGAAGAACAAGAAGAACATGAATGCCGTCGAAGCCTATGCT
CAAGTCGTTGCTTCCGACGCAAACATGGACCTCTTTGACGACGATGTGAATGAAGACGAGAGAAGAAGCAACAAG
CCCCTTGCAGACGCGAGCGATTATATTGTCGATATTCGAGAGTACGATGTGCCATATCATGTGCGGGTCATGATA
GATTTGGATATAAGGGTGGGGAAATGGTATTTTGTCGAGGCCAAGCATGGGCTGCCGCTCAAGTTTCCCGATGCA
GCGATTGACCAAGTCATGATGATTTCGTACATGATTGATGGGCAGGGCTTCTTGATCACCAACCGCGAGATTATT
TCCGAAGACATTGGGGATTTTGAGTATACGCCCAAGCCAGAGTATCCCGGATGCTTCATGATCTTCAACGAGCCG
AATGAAAAGGCGCTGCTTGAACGGTTCCTTGTGCACGTCAAGGAGGCTCGGCCAACGGTGATTGCGACATACAAC
GGCGACTTTTTCGACTGGCCCTTTGTCGAGGCGCGAGCCAGTTTCCACGGAATCGACCTGTATACAGAGACGGGG
TGGAAAAAGGACAATGACGACCAGTTCAAGTGGTCTCGAGGCCTCAAAGCCGTGACTGTGGCCAAGCTGGGCTAC
GACCCGGACGAGCTGGATCCCGAGCTCATGCTGCCGTATGCCAGTGAGCGGCCGCAGACGCTGGCCGAGTACTCG
GTGTCGGACGCGGTGGCGACGTACTACTTGTACATGAAATACGGAACGGGGACTCTGTGCGAGATGCTGCTCATG
GCGCCCAAGGAGGCCTTTTGGGAGGGCCACCTGCTCGACTCGGAGACGTACGTGGGCGGGCATGTGGAGAGCATC
GAGGCGGGCGTGTTCCGGTCAGACATTGCCGTGGACTTTGCCGTGGACGCTGGGGCGGTGGACGAGCTGCTGCGG
GACCTGGACGCGGCGCTCGAGTTTGTGCTGACGGTGGAGGAGAAGCAGTCGCTCGACGACGTGGACAACTTGGCC
GAGGTCAAGCAGCAGATTGTGGACAGGCTGATGAAGCTCAAGGAGACGCCCAACCGGCACGAGCAGCCGCTCATC
TACCACCTGGACCCCGACTCGATGATTTCCGAGTCGGACTGTGCGGCGTGCGACTTTAACCGGCCGGGCAAGACG
TGCGACCGACGGCTGCCCGCGCTGGAGAGCGAAAAGTTTGCGGGCAAACACGCCAAGGCGCCAATGCGGCCCTTT
CAAGACTTGCCGGCGGACGAGCAGGCCAGCCTGGTGCGCGAGGCCATCATCTGCCAGCGCGAGAACCCGTTTTAC
ATCAACACGGTGCGCGACTTTCGCGACCGGCGCTACGACTACAAGGGCCAGGCCAAGGTGTGGAAGGGCAAGGCC
GAGGCGCTCAAGAGCCAGGGCGGGACGGGCAGCGAGATTGAGGCGGCCAACAAGATGGTTGTGGTGTACGACTCG
CTGCAGCTGGCGCACAAGGTGATTCTCAACTCGTTCTACGGCTACGTGATGCGCAAGGGGTCGCGGTGGTACTCG
ATGGAGATGGCGGGCGTGACGTGTCTGACGGGGGCGACGATTATCCAGATGGCGCGGCAGCTGGTGGAGCGGCTG
GGGCGGCCGCTGGAGCTGGACACGGACGGCATCTGGTGCATGCTGCCGGCGACGTTTCCCGAAAACTTTTGCTTC
CGGCTCAAGAATGGCAAACGGGTCAATATATCGTACCCCTGCGTCATGCTCAACCACTTGGTGCACGCGCGCTTC
ACCAACCACCAATACCAGACGCTGGTGGACGGCAAGACGTTTCGGTACGAGACGCACAGCGACAACTCCATCTTC
TTCGAGGTGGACGGCCCGTACAAGGCCATGGTGCTGCCCACGTCCAAGGAGGAGGACAAGAACCTCAAGAAGCGC
TACGCCGTCTTCAACCACGACGGGACGCTGGCGGAGCTCAAGGGCTTTGAGCTGAAGCGGCGCGGCGAGCTCAAG
CTCATCAAGATTTTCCAGCAGCAGATTTTCGGCTTCTTCTTGCAGGGCAGCAACCTGGGCGAGTGCTACGGGGCG
GTGGCCAAGGTGGCGAACCGGTGGCTGGACGTGCTGCACAACAAGGGCACGACGCTGGCGGACGAGGAGCTGATG
GATCTGATTTCGGAAAACAGGAGCATGAGCAAGACGCTGCAAGAGTACGGGACGCAAAAGTCGACGAGCATCACG
ACGGCGCGGCGGCTGGCCGACTTTTTGGGGGAGCAAATGGTCAAGGACAAGGGGCTCAACTGCAAGTTTATCATT
TGCGCCAAGCCGCGCAACGCGCCCGTGACGGAGCGGGCGGTGCCGGTGGCGATTTTCTCGGCCGACGAGGCCACC
AAGCGGGCCTTTCTCAAGAAGTGGCTCAAGGAGGAGCCGGCCAAGACGGACCCGCGGGCGCTGGTGGACTGGGAC
TACTATCTGGAGCGGCTGGGGTCCGTCATCCAAAAGCTGATTACTATTCCGGCGGCGCTGCAGCGGCTGCGCAAC
CCGGTGCCGCGGGTGGCGCACCCCGACTGGCTGCAGAAGCGCATCAACACCAAGGACGACCGGATGAAGCAGAAG
AAGCTGACCGACATGGCCAAGGTGCGGGTGGGGCGGGCCGACGACATGGAGGACTTTGGCAGCAGGCTGCTGCGG
CCCAAGGCGGTCGAGGTTGCCTTGGCGTCGTCGCAGGCGTCGTCGCAGGCGTCGTNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNGGCGGCGACGACGACGGCGGTCTGGCACAAGGCATGGCAGGCCTCCCTGCAACGGT
GCCGGACCCGTCTCGCGACTACGTTGCCTTTTTGGACTCTTTGGGCAGACCAAGCAGACGGGGCCGGGCGGCGGC
GGCAACAGCAACATCGAGCACCGGTTCCAGAAGCAGGCTCACGCGACGTTTATGAAGCCGTGGCAGCTGCTCCAG
ATCAAGCCCAGCACCAAGGCCGGGGAGGTGAGGGCGCACGTGCTGATTGACAAGCGCATACACAGCGTCAAGCTG
GTGGTGCCTCGACAAGTCTATGTCAACATCAAGAGCGGCAGCGCCATGCCCGACGTGGACATTGCCGGGTGCGAG
GTGGAGCAGGTCAACTCGACGCTGCCGAGCGGACAGGGGTCGAGCCGGCTGTTCAAGCTGACGGTGGCGGAGAGC
GTCTATAGCAGCGAGGCCGAGGCGTGCCGCTGA
Transcript >OphauG2|5335
ATGCCCAACACCAGTCTACGTCGCCCGGAAAAGGGCGTTCGCCGTGGAGGCAAAACCGCGTACCACGGCGGACGG
CCGCAGCGCGTGTTTGCCGCTACAGCGCGGGCCGAGGGCACGTCGGCCGAGGAGAAATGGGAGCGGGTCAAGCTG
GCGCAAACAATTGACGAGGACATGGGCTTTGCGCGCTATTCCAGTGGCAAGCGCAGACAAGGATGGCTAGTCAAT
GTGCAGCCGGCATCTGTTGAAGATGAGAGAAACATTGGCGGCCGGGCGGCGCTGGATTGCTACTTTATCCAGGAG
GATAGCTCGACCTTCAAGGCAACGATTGAATACGAGCCTTACTTTCTTGTGGCTGTCAAGCGAGGTCGAGAGTTG
GAGGCCGAGGAATGGATCAAGCGGGTGCCAGGCGACGGCGTGGTCAAGTCGGTTCGCAGAATTGAAAAGGACGAT
TTGAGTCTGCCCAACCACTTGCTGGGCCATCGGCGAACTTTGCTTGAGCTTCGCTTTTCCAACGTTCGGGATCTC
ATGGCTGCGAGGAACGACTTGCTGCCTGTGGCGGAGAAGAACAAGAAGAACATGAATGCCGTCGAAGCCTATGCT
CAAGTCGTTGCTTCCGACGCAAACATGGACCTCTTTGACGACGATGTGAATGAAGACGAGAGAAGAAGCAACAAG
CCCCTTGCAGACGCGAGCGATTATATTGTCGATATTCGAGAGTACGATGTGCCATATCATGTGCGGGTCATGATA
GATTTGGATATAAGGGTGGGGAAATGGTATTTTGTCGAGGCCAAGCATGGGCTGCCGCTCAAGTTTCCCGATGCA
GCGATTGACCAAGTCATGATGATTTCGTACATGATTGATGGGCAGGGCTTCTTGATCACCAACCGCGAGATTATT
TCCGAAGACATTGGGGATTTTGAGTATACGCCCAAGCCAGAGTATCCCGGATGCTTCATGATCTTCAACGAGCCG
AATGAAAAGGCGCTGCTTGAACGGTTCCTTGTGCACGTCAAGGAGGCTCGGCCAACGGTGATTGCGACATACAAC
GGCGACTTTTTCGACTGGCCCTTTGTCGAGGCGCGAGCCAGTTTCCACGGAATCGACCTGTATACAGAGACGGGG
TGGAAAAAGGACAATGACGACCAGTTCAAGTGGTCTCGAGGCCTCAAAGCCGTGACTGTGGCCAAGCTGGGCTAC
GACCCGGACGAGCTGGATCCCGAGCTCATGCTGCCGTATGCCAGTGAGCGGCCGCAGACGCTGGCCGAGTACTCG
GTGTCGGACGCGGTGGCGACGTACTACTTGTACATGAAATACGGAACGGGGACTCTGTGCGAGATGCTGCTCATG
GCGCCCAAGGAGGCCTTTTGGGAGGGCCACCTGCTCGACTCGGAGACGTACGTGGGCGGGCATGTGGAGAGCATC
GAGGCGGGCGTGTTCCGGTCAGACATTGCCGTGGACTTTGCCGTGGACGCTGGGGCGGTGGACGAGCTGCTGCGG
GACCTGGACGCGGCGCTCGAGTTTGTGCTGACGGTGGAGGAGAAGCAGTCGCTCGACGACGTGGACAACTTGGCC
GAGGTCAAGCAGCAGATTGTGGACAGGCTGATGAAGCTCAAGGAGACGCCCAACCGGCACGAGCAGCCGCTCATC
TACCACCTGGACCCCGACTCGATGATTTCCGAGTCGGACTGTGCGGCGTGCGACTTTAACCGGCCGGGCAAGACG
TGCGACCGACGGCTGCCCGCGCTGGAGAGCGAAAAGTTTGCGGGCAAACACGCCAAGGCGCCAATGCGGCCCTTT
CAAGACTTGCCGGCGGACGAGCAGGCCAGCCTGGTGCGCGAGGCCATCATCTGCCAGCGCGAGAACCCGTTTTAC
ATCAACACGGTGCGCGACTTTCGCGACCGGCGCTACGACTACAAGGGCCAGGCCAAGGTGTGGAAGGGCAAGGCC
GAGGCGCTCAAGAGCCAGGGCGGGACGGGCAGCGAGATTGAGGCGGCCAACAAGATGGTTGTGGTGTACGACTCG
CTGCAGCTGGCGCACAAGGTGATTCTCAACTCGTTCTACGGCTACGTGATGCGCAAGGGGTCGCGGTGGTACTCG
ATGGAGATGGCGGGCGTGACGTGTCTGACGGGGGCGACGATTATCCAGATGGCGCGGCAGCTGGTGGAGCGGCTG
GGGCGGCCGCTGGAGCTGGACACGGACGGCATCTGGTGCATGCTGCCGGCGACGTTTCCCGAAAACTTTTGCTTC
CGGCTCAAGAATGGCAAACGGGTCAATATATCGTACCCCTGCGTCATGCTCAACCACTTGGTGCACGCGCGCTTC
ACCAACCACCAATACCAGACGCTGGTGGACGGCAAGACGTTTCGGTACGAGACGCACAGCGACAACTCCATCTTC
TTCGAGGTGGACGGCCCGTACAAGGCCATGGTGCTGCCCACGTCCAAGGAGGAGGACAAGAACCTCAAGAAGCGC
TACGCCGTCTTCAACCACGACGGGACGCTGGCGGAGCTCAAGGGCTTTGAGCTGAAGCGGCGCGGCGAGCTCAAG
CTCATCAAGATTTTCCAGCAGCAGATTTTCGGCTTCTTCTTGCAGGGCAGCAACCTGGGCGAGTGCTACGGGGCG
GTGGCCAAGGTGGCGAACCGGTGGCTGGACGTGCTGCACAACAAGGGCACGACGCTGGCGGACGAGGAGCTGATG
GATCTGATTTCGGAAAACAGGAGCATGAGCAAGACGCTGCAAGAGTACGGGACGCAAAAGTCGACGAGCATCACG
ACGGCGCGGCGGCTGGCCGACTTTTTGGGGGAGCAAATGGTCAAGGACAAGGGGCTCAACTGCAAGTTTATCATT
TGCGCCAAGCCGCGCAACGCGCCCGTGACGGAGCGGGCGGTGCCGGTGGCGATTTTCTCGGCCGACGAGGCCACC
AAGCGGGCCTTTCTCAAGAAGTGGCTCAAGGAGGAGCCGGCCAAGACGGACCCGCGGGCGCTGGTGGACTGGGAC
TACTATCTGGAGCGGCTGGGGTCCGTCATCCAAAAGCTGATTACTATTCCGGCGGCGCTGCAGCGGCTGCGCAAC
CCGGTGCCGCGGGTGGCGCACCCCGACTGGCTGCAGAAGCGCATCAACACCAAGGACGACCGGATGAAGCAGAAG
AAGCTGACCGACATGGCCAAGGTGCGGGTGGGGCGGGCCGACGACATGGAGGACTTTGGCAGCAGGCTGCTGCGG
CCCAAGGCGGTCGAGGTTGCCTTGGCGTCGTCGCAGGCGTCGTCGCAGGCGTCGTNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNGGCGGCGACGACGACGGCGGTCTGGCACAAGGCATGGCAGGCCTCCCTGCAACGGT
GCCGGACCCGTCTCGCGACTACGTTGCCTTTTTGGACTCTTTGGGCAGACCAAGCAGACGGGGCCGGGCGGCGGC
GGCAACAGCAACATCGAGCACCGGTTCCAGAAGCAGGCTCACGCGACGTTTATGAAGCCGTGGCAGCTGCTCCAG
ATCAAGCCCAGCACCAAGGCCGGGGAGGTGAGGGCGCACGTGCTGATTGACAAGCGCATACACAGCGTCAAGCTG
GTGGTGCCTCGACAAGTCTATGTCAACATCAAGAGCGGCAGCGCCATGCCCGACGTGGACATTGCCGGGTGCGAG
GTGGAGCAGGTCAACTCGACGCTGCCGAGCGGACAGGGGTCGAGCCGGCTGTTCAAGCTGACGGTGGCGGAGAGC
GTCTATAGCAGCGAGGCCGAGGCGTGCCGCTGA
Gene >OphauG2|5335
ATGCCCAACACCAGTCTACGTCGCCCGGAAAAGGGCGTTCGCCGTGGAGGCAAAACCGCGTACCACGGCGGACGG
CCGCAGCGCGTGTTTGCCGCTACAGCGCGGGCCGAGGGCACGTCGGCCGAGGAGAAATGGGAGCGGGTCAAGCTG
GCGCAAACAATTGACGAGGACATGGGCTTTGCGCGCTATTCCAGTGGCAAGCGCAGACAAGGATGGCTAGTCAAT
GTGCAGCCGGCATCTGTTGAAGATGAGAGAAACATTGGCGGCCGGGCGGCGCTGGATTGCTACTTTATCCAGGAG
GATAGCTCGACCTTCAAGGCAACGATTGAATACGAGCCTTACTTTCTTGTGGCTGTCAAGCGAGGTCGAGAGTTG
GAGGCCGAGGAATGGATCAAGCGGGTGCCAGGCGACGGCGTGGTCAAGTCGGTTCGCAGAATTGAAAAGGACGAT
TTGAGTCTGCCCAACCACTTGCTGGGCCATCGGCGAACTTTGCTTGAGCTTCGCTTTTCCAACGTTCGGGATCTC
ATGGCTGCGAGGAACGACTTGCTGCCTGTGGCGGAGAAGAACAAGAAGAACATGAATGCCGTCGAAGCCTATGCT
CAAGTCGTTGCGTACGTCTGTGGCTGTCGCACCAACATGGTGGTTGCATTGACTAACTTGATCATGGTTTTAGTT
CCGACGCAAACATGGACCTCTTTGACGACGATGTGAATGAAGACGAGAGAAGAAGCAACAAGCCCCTTGCAGACG
CGAGCGATTATATTGTCGATATTCGAGAGTACGATGTGCCATATCATGTGCGGGTCATGATAGATTTGGGTGAGC
TAGACCGAGAGGAAATAACAAACAAGAGTGTGCTGTAGGTACAAGACAGGCTGACATTTGGGCTGGATTCACGAC
AGATATAAGGGTGGGGAAATGGTATTTTGTCGAGGCCAAGCATGGGGTAACGCGAGTGTGGCCCAACCAAGAAAA
GTCGCTACCGGCGGAGCCTGTGGTGTTGGCTTTTGACATCGAAACGACAAAGCTGCCGCTCAAGTTTCCCGATGC
AGCGATTGACCAAGTCATGATGATTTCGTACATGATTGATGGGCAGGGCTTCTTGATCACCAACCGCGAGATTAT
TTCCGAAGACATTGGGGATTTTGAGTATACGCCCAAGCCAGAGTATCCCGGATGCTTCATGATCTTCAACGAGCC
GAATGAAAAGGCGCTGCTTGAACGGTTCCTTGTGCACGTCAAGGAGGCTCGGCCAACGGTGATTGCGACATACAA
CGGCGACTTTTTCGACTGGCCCTTTGTCGAGGCGCGAGCCAGTTTCCACGGAATCGACCTGTATACAGAGACGGG
GTGGAAAAAGGACAATGACGACCAGTTCAAGTGTAACTACAGCGTGCATATGGACTGCTTCCACTGGGTCAATCG
AGACTCGTATCTGCCCCAAGGGTCTCGAGGCCTCAAAGCCGTGACTGTGGCCAAGCTGGGCTACGACCCGGACGA
GCTGGATCCCGAGCTCATGCTGCCGTATGCCAGTGAGCGGCCGCAGACGCTGGCCGAGTACTCGGTGTCGGACGC
GGTGGCGACGTACTACTTGTACATGAAATACGTGCACCCCTTCATCTTCTCGCTGTGCACCATTTTGCCGCTGGG
GCCGGACGACACGCTGAGAAAGGGAACGGGGACTCTGTGCGAGATGCTGCTCATGGTGCAAGCATACCAAAAGGA
AATCGTGCTGCCAAACAAGCACCAGGCGCCCAAGGAGGCCTTTTGGGAGGGCCACCTGCTCGACTCGGAGACGTA
CGTGGGCGGGCATGTGGAGAGCATCGAGGCGGGCGTGTTCCGGTCAGACATTGCCGTGGACTTTGCCGTGGACGC
TGGGGCGGTGGACGAGCTGCTGCGGGACCTGGACGCGGCGCTCGAGTTTGTGCTGACGGTGGAGGAGAAGCAGTC
GCTCGACGACGTGGACAACTTGGCCGAGGTCAAGCAGCAGATTGTGGACAGGCTGATGAAGCTCAAGGAGACGCC
CAACCGGCACGAGCAGCCGCTCATCTACCACCTGGACGTTGCCTCCATGTACCCCAACATCATGACGACGAACCG
GCTGCAGCCCGACTCGATGATTTCCGAGTCGGACTGTGCGGCGTGCGACTTTAACCGGCCGGGCAAGACGTGCGA
CCGACGGCTGCCGTGGGCGTGGCGCGGCGAGTACATTCCGGCCAAGCGCGGCGAGTACAACATGATTCGCAGCGC
GCTGGAGAGCGAAAAGTTTGCGGGCAAACACGCCAAGGCGCCAATGCGGCCCTTTCAAGACTTGCCGGCGGACGA
GCAGGCCAGCCTGGTGCGCAAGCGACTGCAGATGTACTCGCAAAAGGTCTACCACAAGATCCACGACAGCACGAC
CAAGGTGCGCGAGGCCATCATCTGCCAGCGCGAGAACCCGTTTTACATCAACACGGTGCGCGACTTTCGCGACCG
GCGCTACGACTACAAGGGCCAGGCCAAGGTGTGGAAGGGCAAGGCCGAGGCGCTCAAGAGCCAGGGCGGGACGGG
CAGCGAGATTGAGGCGGCCAACAAGATGGTTGTGGTGTACGACTCGCTGCAGCTGGCGCACAAGGTGATTCTCAA
CTCGTTCTACGGCTACGTGATGCGCAAGGGGTCGCGGTGGTACTCGATGGAGATGGCGGGCGTGACGTGTCTGAC
GGGGGCGACGATTATCCAGATGGCGCGGCAGCTGGTGGAGCGGCTGGGGCGGCCGCTGGAGCTGGACACGGACGG
CATCTGGTGCATGCTGCCGGCGACGTTTCCCGAAAACTTTTGCTTCCGGCTCAAGAATGGCAAACGGGTCAATAT
ATCGTACCCCTGCGTCATGCTCAACCACTTGGTGCACGCGCGCTTCACCAACCACCAATACCAGACGCTGGTGGA
CGGCAAGACGTTTCGGTACGAGACGCACAGCGACAACTCCATCTTCTTCGAGGTGGACGGCCCGTACAAGGCCAT
GGTGCTGCCCACGTCCAAGGAGGAGGACAAGAACCTCAAGAAGCGCTACGCCGTCTTCAACCACGACGGGACGCT
GGCGGAGCTCAAGGGCTTTGAGCTGAAGCGGCGCGGCGAGCTCAAGCTCATCAAGATTTTCCAGCAGCAGATTTT
CGGCTTCTTCTTGCAGGGCAGCAACCTGGGCGAGTGCTACGGGGCGGTGGCCAAGGTGGCGAACCGGTGGCTGGA
CGTGCTGCACAACAAGGGCACGACGCTGGCGGACGAGGAGCTGATGGATCTGATTTCGGAAAACAGGAGCATGAG
CAAGACGCTGCAAGAGTACGGGACGCAAAAGTCGACGAGCATCACGACGGCGCGGCGGCTGGCCGACTTTTTGGG
GGAGCAAATGGTCAAGGACAAGGGGCTCAACTGCAAGTTTATCATTTGCGCCAAGCCGCGCAACGCGCCCGTGAC
GGAGCGGGCGGTGCCGGTGGCGATTTTCTCGGCCGACGAGGCCACCAAGCGGGCCTTTCTCAAGAAGTGGCTCAA
GGAGGAGCCGGCCAAGACGGACCCGCGGGCGCTGGTGGACTGGGACTACTATCTGGAGCGGCTGGGGTCCGTCAT
CCAAAAGCTGATTACTATTCCGGCGGCGCTGCAGCGGCTGCGCAACCCGGTGCCGCGGGTGGCGCACCCCGACTG
GCTGCAGAAGCGCATCAACACCAAGGACGACCGGATGAAGCAGAAGAAGCTGACCGACATGGCCAAGGTGCGGGT
GGGGCGGGCCGACGACATGGAGGACTTTGGCAGCAGGCTGCTGCGGCCCAAGGCGGTCGAGGTTGCCTTGGCGTC
GTCGCAGGCGTCGTCGCAGGCGTCGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCGGCGACG
ACGACGGCGGTCTGGCACAAGGCATGGCAGGCCTCCCTGCAACGGTGCCGGACCCGTCTCGCGACTACGTTGCCT
TTTTGGAGTACCAAAAGAAGAAGTGGAGGGTGCAGAAGCAAGCTCGCATCCGGCGGCGGCAGCTCTTTGGGCAGA
CCAAGCAGACGGGGCCGGGCGGCGGCGGCAACAGCAACATCGAGCACCGGTTCCAGAAGCAGGCTCACGCGACGT
TTATGAAGCCGTGGCAGCTGCTCCAGATCAAGCCCAGCACCAAGGCCGGGGAGGTGAGGGCGCACGTGCTGATTG
ACAAGCGCATACACAGCGTCAAGCTGGTGGTGCCTCGACAAGTCTATGTCAACATCAAGAGCGGCAGCGCCATGC
CCGACGTGGACATTGCCGGGTGCGAGGTGGAGCAGGTCAACTCGACGCTGCCGAGCGGACAGGGGTCGAGCCGGC
TGTTCAAGCTGACGGTGGCGGAGAGCGTCTATAGCAGCGAGGCCGAGGCGTTTGGGCGGCTGTTCAAGCACAGCA
GCGTCGAGGGCGTGTACGAGACGCAGGTGCCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail