Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5331
Gene name
LocationContig_486:6333..8384
Strand+
Gene length (bp)2051
Transcript length (bp)1998
Coding sequence length (bp)1998
Protein length (aa) 666

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2002
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5331 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7634
Ophiocordyceps camponoti-floridani Ophcf2|00434
Ophiocordyceps camponoti-rufipedis Ophun1|7037
Ophiocordyceps kimflemingae Ophio5|678
Ophiocordyceps subramaniannii Hirsu2|2242

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5331
MPRRAATSATSRSGTTKSIRGHISGPMPIHNSALTKPDVAIRHAATSPVALAPYSNCHQDHTTPERLITHGQTKD
TLPPFEPPCRDDVAPSRYSEAVPTSAARSGASPCKVTMNHAAPPKKSPLRSALDKLFGRNKKKSTLAQSGHLSTK
AVPKPSSRHHRSDPTGQHVPIRTLEPKRSASLPVTEYDRALRSHSIGPDDVRAIRSARNSINADPKTSTYVTALL
NSSPYLMRPAQPRWTETRKFTGLSPRPASSHARRSKMTSLSHDGGEIGRAITSDSASGLRRRSRSLAALHLPDTS
NSGHIRRRSDDIRQWRDNFEPAAGSLLFASTAPEVENLGTSSPSTADEPETVVEEQTRPPQSQIADEDIGSVKEA
ARLRITEAANLSSRLTSLEARISRLEPVLAGLDKFVWEVGSHPNTPGQEIPSIQVKQKLETTGQVPRNRASDYEQ
ASPIRPSMDRSNASEATFGGALLHHNGSQKDTLQPLPLKDSRPPSLTTIRNNQMATVQPLTPDVYASLLALIESE
RIARQALAAQVRRLSHQLNLRTKSTGHVRPAQSHLPRGDKPVAGIGLFDQDEGVGGCGTNGGEHSRHSMRLDDSG
FSAGNCDDEHSESCAGPYEGDGDDSDSGEDDEIAIRTATRALSLSRLTHGKMQPTRLEGIPRAMV*
Coding >OphauG2|5331
ATGCCGCGAAGAGCTGCCACCAGCGCTACCTCGCGCAGTGGAACCACCAAGTCGATCCGCGGTCACATTTCCGGG
CCCATGCCAATTCACAATTCGGCTCTGACAAAGCCCGACGTTGCTATTCGCCATGCTGCTACTTCTCCCGTCGCC
TTGGCTCCATATAGCAACTGCCACCAAGACCACACGACGCCTGAGAGATTGATTACCCATGGACAGACCAAGGAC
ACACTACCGCCTTTTGAGCCACCGTGTCGTGACGATGTTGCACCAAGCCGCTACTCCGAGGCCGTGCCTACTTCT
GCCGCCAGGTCAGGCGCCTCGCCTTGCAAAGTCACCATGAACCATGCTGCCCCACCCAAAAAGTCGCCTCTTCGA
TCTGCTTTGGACAAGCTCTTCGGCCGCAACAAAAAGAAGAGCACCTTGGCTCAGAGTGGCCACTTGTCGACCAAA
GCTGTACCAAAACCTTCCAGTCGTCATCACCGAAGCGATCCAACGGGCCAACATGTGCCCATCAGAACTTTGGAA
CCCAAGCGCTCTGCTTCTCTGCCCGTTACCGAGTATGACCGCGCCTTACGTTCTCACTCGATTGGTCCCGACGAT
GTCAGAGCTATTAGGAGCGCTCGAAATTCTATTAACGCCGACCCCAAAACATCCACCTACGTTACTGCTCTCCTC
AATTCTTCTCCATACCTCATGCGCCCAGCTCAACCACGTTGGACAGAGACTCGCAAGTTTACCGGCTTGTCTCCA
CGTCCAGCAAGCTCTCATGCGCGCCGTTCCAAAATGACCAGCTTGAGCCATGATGGTGGCGAGATTGGCCGAGCC
ATCACAAGCGACTCTGCAAGTGGGCTGAGACGACGCTCACGTAGCCTTGCTGCTCTCCACTTACCCGACACAAGC
AATTCGGGTCACATCAGGCGGCGCAGCGACGACATTCGCCAATGGCGAGATAATTTTGAGCCTGCTGCCGGCTCT
CTTCTGTTTGCCTCAACCGCCCCCGAGGTGGAAAACCTGGGCACTTCGAGCCCTTCGACCGCTGATGAGCCCGAG
ACTGTTGTCGAGGAACAGACTCGGCCTCCCCAATCACAAATTGCTGATGAGGATATTGGTTCTGTCAAGGAGGCC
GCGCGTCTAAGAATTACCGAAGCTGCCAATCTCAGCTCGCGTCTCACCAGCCTTGAGGCTCGGATAAGCCGCCTG
GAACCCGTCTTGGCTGGCCTGGACAAGTTTGTGTGGGAAGTTGGCAGTCATCCCAACACACCTGGCCAGGAAATT
CCCTCAATTCAAGTGAAGCAGAAACTCGAGACCACGGGCCAAGTGCCAAGAAACCGTGCCTCTGATTATGAGCAA
GCCAGCCCCATTCGTCCCTCGATGGATCGCTCCAACGCGTCCGAGGCAACATTTGGTGGGGCCCTTTTGCATCAT
AATGGCTCGCAGAAAGACACCCTGCAGCCTCTACCATTGAAGGATAGCAGACCGCCTTCCCTGACGACGATTCGC
AATAATCAAATGGCAACAGTGCAGCCCCTCACCCCCGACGTTTATGCGTCCCTGTTGGCTCTCATTGAGTCTGAA
CGCATTGCCCGGCAAGCCCTTGCGGCCCAGGTTAGGAGATTAAGCCATCAACTCAATCTTCGGACCAAGAGCACA
GGCCACGTCCGTCCCGCGCAAAGCCACTTGCCCAGGGGCGACAAGCCAGTGGCGGGTATAGGCTTGTTTGATCAA
GACGAAGGAGTTGGAGGCTGCGGCACGAATGGGGGAGAACATTCACGCCACAGTATGCGTCTAGATGACTCCGGG
TTTTCAGCTGGAAACTGTGACGACGAACACAGTGAATCATGCGCTGGCCCGTACGAGGGGGACGGCGACGACTCA
GACTCGGGCGAAGATGATGAAATAGCCATCAGAACGGCGACCCGGGCATTGTCACTCTCACGGCTTACTCATGGA
AAGATGCAGCCGACGAGACTGGAGGGTATACCCAGGGCCATGGTTTAA
Transcript >OphauG2|5331
ATGCCGCGAAGAGCTGCCACCAGCGCTACCTCGCGCAGTGGAACCACCAAGTCGATCCGCGGTCACATTTCCGGG
CCCATGCCAATTCACAATTCGGCTCTGACAAAGCCCGACGTTGCTATTCGCCATGCTGCTACTTCTCCCGTCGCC
TTGGCTCCATATAGCAACTGCCACCAAGACCACACGACGCCTGAGAGATTGATTACCCATGGACAGACCAAGGAC
ACACTACCGCCTTTTGAGCCACCGTGTCGTGACGATGTTGCACCAAGCCGCTACTCCGAGGCCGTGCCTACTTCT
GCCGCCAGGTCAGGCGCCTCGCCTTGCAAAGTCACCATGAACCATGCTGCCCCACCCAAAAAGTCGCCTCTTCGA
TCTGCTTTGGACAAGCTCTTCGGCCGCAACAAAAAGAAGAGCACCTTGGCTCAGAGTGGCCACTTGTCGACCAAA
GCTGTACCAAAACCTTCCAGTCGTCATCACCGAAGCGATCCAACGGGCCAACATGTGCCCATCAGAACTTTGGAA
CCCAAGCGCTCTGCTTCTCTGCCCGTTACCGAGTATGACCGCGCCTTACGTTCTCACTCGATTGGTCCCGACGAT
GTCAGAGCTATTAGGAGCGCTCGAAATTCTATTAACGCCGACCCCAAAACATCCACCTACGTTACTGCTCTCCTC
AATTCTTCTCCATACCTCATGCGCCCAGCTCAACCACGTTGGACAGAGACTCGCAAGTTTACCGGCTTGTCTCCA
CGTCCAGCAAGCTCTCATGCGCGCCGTTCCAAAATGACCAGCTTGAGCCATGATGGTGGCGAGATTGGCCGAGCC
ATCACAAGCGACTCTGCAAGTGGGCTGAGACGACGCTCACGTAGCCTTGCTGCTCTCCACTTACCCGACACAAGC
AATTCGGGTCACATCAGGCGGCGCAGCGACGACATTCGCCAATGGCGAGATAATTTTGAGCCTGCTGCCGGCTCT
CTTCTGTTTGCCTCAACCGCCCCCGAGGTGGAAAACCTGGGCACTTCGAGCCCTTCGACCGCTGATGAGCCCGAG
ACTGTTGTCGAGGAACAGACTCGGCCTCCCCAATCACAAATTGCTGATGAGGATATTGGTTCTGTCAAGGAGGCC
GCGCGTCTAAGAATTACCGAAGCTGCCAATCTCAGCTCGCGTCTCACCAGCCTTGAGGCTCGGATAAGCCGCCTG
GAACCCGTCTTGGCTGGCCTGGACAAGTTTGTGTGGGAAGTTGGCAGTCATCCCAACACACCTGGCCAGGAAATT
CCCTCAATTCAAGTGAAGCAGAAACTCGAGACCACGGGCCAAGTGCCAAGAAACCGTGCCTCTGATTATGAGCAA
GCCAGCCCCATTCGTCCCTCGATGGATCGCTCCAACGCGTCCGAGGCAACATTTGGTGGGGCCCTTTTGCATCAT
AATGGCTCGCAGAAAGACACCCTGCAGCCTCTACCATTGAAGGATAGCAGACCGCCTTCCCTGACGACGATTCGC
AATAATCAAATGGCAACAGTGCAGCCCCTCACCCCCGACGTTTATGCGTCCCTGTTGGCTCTCATTGAGTCTGAA
CGCATTGCCCGGCAAGCCCTTGCGGCCCAGGTTAGGAGATTAAGCCATCAACTCAATCTTCGGACCAAGAGCACA
GGCCACGTCCGTCCCGCGCAAAGCCACTTGCCCAGGGGCGACAAGCCAGTGGCGGGTATAGGCTTGTTTGATCAA
GACGAAGGAGTTGGAGGCTGCGGCACGAATGGGGGAGAACATTCACGCCACAGTATGCGTCTAGATGACTCCGGG
TTTTCAGCTGGAAACTGTGACGACGAACACAGTGAATCATGCGCTGGCCCGTACGAGGGGGACGGCGACGACTCA
GACTCGGGCGAAGATGATGAAATAGCCATCAGAACGGCGACCCGGGCATTGTCACTCTCACGGCTTACTCATGGA
AAGATGCAGCCGACGAGACTGGAGGGTATACCCAGGGCCATGGTTTAA
Gene >OphauG2|5331
ATGCCGCGAAGAGCTGCCACCAGCGCTACCTCGCGCAGTGGAACCACCAAGTCGATCCGCGGTCACATTTCCGGG
CCCATGCCAATTCACAATTCGGCTCTGACAAAGCCCGACGTTGCTATTCGCCATGCTGCTACTTCTCCCGTCGCC
TTGGCTCCATATAGCAACTGCCACCAAGACCACACGACGCCTGAGAGATTGATTACCCATGGACAGACCAAGGAC
ACACTACCGCCTTTTGAGCCACCGTGTCGTGACGATGTTGCACCAAGCCGCTACTCCGAGGCCGTGCCTACTTCT
GCCGCCAGGTCAGGCGCCTCGCCTTGCAAAGTCACCATGAACCATGCTGCCCCACCCAAAAAGTCGCCTCTTCGA
TCTGCTTTGGACAAGCTCTTCGGCCGCAACAAAAAGAAGAGCACCTTGGCTCAGAGTGGCCACTTGTCGACCAAA
GCTGTACCAAAACCTTCCAGTCGTCATCACCGAAGCGTAAGCCATGGCCATTGTTGTCTGTCAGGAGTGGGCGAC
TAACACGAGTACAGGATCCAACGGGCCAACATGTGCCCATCAGAACTTTGGAACCCAAGCGCTCTGCTTCTCTGC
CCGTTACCGAGTATGACCGCGCCTTACGTTCTCACTCGATTGGTCCCGACGATGTCAGAGCTATTAGGAGCGCTC
GAAATTCTATTAACGCCGACCCCAAAACATCCACCTACGTTACTGCTCTCCTCAATTCTTCTCCATACCTCATGC
GCCCAGCTCAACCACGTTGGACAGAGACTCGCAAGTTTACCGGCTTGTCTCCACGTCCAGCAAGCTCTCATGCGC
GCCGTTCCAAAATGACCAGCTTGAGCCATGATGGTGGCGAGATTGGCCGAGCCATCACAAGCGACTCTGCAAGTG
GGCTGAGACGACGCTCACGTAGCCTTGCTGCTCTCCACTTACCCGACACAAGCAATTCGGGTCACATCAGGCGGC
GCAGCGACGACATTCGCCAATGGCGAGATAATTTTGAGCCTGCTGCCGGCTCTCTTCTGTTTGCCTCAACCGCCC
CCGAGGTGGAAAACCTGGGCACTTCGAGCCCTTCGACCGCTGATGAGCCCGAGACTGTTGTCGAGGAACAGACTC
GGCCTCCCCAATCACAAATTGCTGATGAGGATATTGGTTCTGTCAAGGAGGCCGCGCGTCTAAGAATTACCGAAG
CTGCCAATCTCAGCTCGCGTCTCACCAGCCTTGAGGCTCGGATAAGCCGCCTGGAACCCGTCTTGGCTGGCCTGG
ACAAGTTTGTGTGGGAAGTTGGCAGTCATCCCAACACACCTGGCCAGGAAATTCCCTCAATTCAAGTGAAGCAGA
AACTCGAGACCACGGGCCAAGTGCCAAGAAACCGTGCCTCTGATTATGAGCAAGCCAGCCCCATTCGTCCCTCGA
TGGATCGCTCCAACGCGTCCGAGGCAACATTTGGTGGGGCCCTTTTGCATCATAATGGCTCGCAGAAAGACACCC
TGCAGCCTCTACCATTGAAGGATAGCAGACCGCCTTCCCTGACGACGATTCGCAATAATCAAATGGCAACAGTGC
AGCCCCTCACCCCCGACGTTTATGCGTCCCTGTTGGCTCTCATTGAGTCTGAACGCATTGCCCGGCAAGCCCTTG
CGGCCCAGGTTAGGAGATTAAGCCATCAACTCAATCTTCGGACCAAGAGCACAGGCCACGTCCGTCCCGCGCAAA
GCCACTTGCCCAGGGGCGACAAGCCAGTGGCGGGTATAGGCTTGTTTGATCAAGACGAAGGAGTTGGAGGCTGCG
GCACGAATGGGGGAGAACATTCACGCCACAGTATGCGTCTAGATGACTCCGGGTTTTCAGCTGGAAACTGTGACG
ACGAACACAGTGAATCATGCGCTGGCCCGTACGAGGGGGACGGCGACGACTCAGACTCGGGCGAAGATGATGAAA
TAGCCATCAGAACGGCGACCCGGGCATTGTCACTCTCACGGCTTACTCATGGAAAGATGCAGCCGACGAGACTGG
AGGGTATACCCAGGGCCATGGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail