Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5320
Gene name
LocationContig_484:5460..6607
Strand-
Gene length (bp)1147
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 1.6E-57 40 354

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D3ZN43|NDUF6_RAT NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Rattus norvegicus GN=Ndufaf6 PE=3 SV=1 36 339 5.0E-43
sp|A2AIL4|NDUF6_MOUSE NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Mus musculus GN=Ndufaf6 PE=1 SV=1 36 339 7.0E-43
sp|A7YVD7|NDUF6_BOVIN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Bos taurus GN=NDUFAF6 PE=2 SV=1 35 277 5.0E-40
sp|Q330K2|NDUF6_HUMAN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Homo sapiens GN=NDUFAF6 PE=1 SV=2 36 339 2.0E-38
sp|Q9VYS5|NDUF6_DROME NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Drosophila melanogaster GN=sicily PE=2 SV=1 35 336 7.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D3ZN43|NDUF6_RAT NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Rattus norvegicus GN=Ndufaf6 PE=3 SV=1 36 339 5.0E-43
sp|A2AIL4|NDUF6_MOUSE NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Mus musculus GN=Ndufaf6 PE=1 SV=1 36 339 7.0E-43
sp|A7YVD7|NDUF6_BOVIN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Bos taurus GN=NDUFAF6 PE=2 SV=1 35 277 5.0E-40
sp|Q330K2|NDUF6_HUMAN NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Homo sapiens GN=NDUFAF6 PE=1 SV=2 36 339 2.0E-38
sp|Q9VYS5|NDUF6_DROME NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Drosophila melanogaster GN=sicily PE=2 SV=1 35 336 7.0E-32
sp|Q54E48|NDUF6_DICDI NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Dictyostelium discoideum GN=DDB_G0291852 PE=3 SV=1 43 275 3.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4501
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5320 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3798
Ophiocordyceps camponoti-floridani Ophcf2|01703
Ophiocordyceps camponoti-rufipedis Ophun1|6337
Ophiocordyceps kimflemingae Ophio5|4294
Ophiocordyceps subramaniannii Hirsu2|9385

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5320
MHRPRLVRSGLKRLAFARPKCRHLTTDADVDAARKYCLARLYDYDAYLVRRFVPRPVQDTYAALRALNLELVRLP
DVISNPTIGAMRIAFWQDSIDQTFSGKPPREPICLLLHHGLQALQARTGSTTKSSAKFWISRLIKTRAKYMDNRP
FPSMASLEDYAENTYSSIMYATLAALPLRSVHMDHLASHIGKACGITAILRGIPLLAARHQPVKTPSGAEAPVTH
QPHFLLPLDVLAEQGVKEEEVFRQGPDAHGLQDAVFAVATRANDHLLTAKDMLKRLKEGQDAGHEFEHGHEAEHV
YSDTDDSAQHVRRGFGVLLEAISAGHHLENLERANFDPFAVRSGGWRLPWKIWQALSKERL*
Coding >OphauG2|5320
ATGCATCGGCCACGACTGGTGCGCAGTGGCCTCAAAAGGCTCGCCTTTGCTCGCCCAAAATGTCGCCACCTCACC
ACGGACGCTGATGTCGATGCGGCCAGGAAATATTGCCTGGCCCGACTCTACGATTACGATGCCTACCTTGTCCGC
CGCTTTGTCCCTCGTCCTGTCCAGGACACCTATGCCGCTCTTCGCGCATTGAATCTCGAGCTTGTCCGGCTTCCA
GATGTTATATCCAATCCAACCATTGGCGCCATGCGCATCGCCTTCTGGCAAGACTCAATAGACCAAACGTTTTCT
GGCAAGCCCCCCCGCGAGCCTATATGCCTACTCCTACACCACGGTCTGCAGGCGCTTCAAGCCAGAACCGGAAGC
ACAACCAAATCGTCCGCCAAGTTTTGGATCTCGCGTCTCATCAAAACACGCGCCAAATACATGGATAACCGTCCT
TTTCCCAGCATGGCCAGCCTCGAAGACTATGCCGAAAACACTTACTCGTCCATCATGTACGCCACGCTGGCTGCC
CTGCCGCTTCGCTCCGTGCACATGGACCACTTGGCTAGCCATATTGGCAAGGCCTGTGGCATCACTGCCATTTTG
CGCGGCATCCCCCTCCTCGCTGCTCGCCATCAGCCTGTCAAGACGCCCTCGGGCGCAGAAGCTCCCGTTACTCAC
CAACCCCATTTCCTCCTTCCCCTTGACGTCCTGGCCGAACAGGGCGTCAAGGAGGAGGAGGTGTTTCGCCAGGGC
CCTGACGCACATGGTCTTCAAGACGCTGTTTTTGCCGTTGCAACACGCGCCAACGACCACCTTTTGACGGCCAAG
GACATGTTGAAGCGACTAAAAGAGGGCCAAGACGCAGGGCACGAGTTTGAACACGGGCACGAGGCGGAGCACGTC
TACAGCGACACAGACGACTCGGCGCAACATGTGCGGCGCGGCTTTGGCGTCTTGCTAGAAGCCATATCTGCAGGC
CATCATCTCGAAAACCTGGAACGCGCCAACTTTGATCCCTTTGCAGTTCGGAGCGGCGGCTGGAGACTGCCGTGG
AAAATATGGCAAGCCCTGTCCAAAGAGCGGTTATGA
Transcript >OphauG2|5320
ATGCATCGGCCACGACTGGTGCGCAGTGGCCTCAAAAGGCTCGCCTTTGCTCGCCCAAAATGTCGCCACCTCACC
ACGGACGCTGATGTCGATGCGGCCAGGAAATATTGCCTGGCCCGACTCTACGATTACGATGCCTACCTTGTCCGC
CGCTTTGTCCCTCGTCCTGTCCAGGACACCTATGCCGCTCTTCGCGCATTGAATCTCGAGCTTGTCCGGCTTCCA
GATGTTATATCCAATCCAACCATTGGCGCCATGCGCATCGCCTTCTGGCAAGACTCAATAGACCAAACGTTTTCT
GGCAAGCCCCCCCGCGAGCCTATATGCCTACTCCTACACCACGGTCTGCAGGCGCTTCAAGCCAGAACCGGAAGC
ACAACCAAATCGTCCGCCAAGTTTTGGATCTCGCGTCTCATCAAAACACGCGCCAAATACATGGATAACCGTCCT
TTTCCCAGCATGGCCAGCCTCGAAGACTATGCCGAAAACACTTACTCGTCCATCATGTACGCCACGCTGGCTGCC
CTGCCGCTTCGCTCCGTGCACATGGACCACTTGGCTAGCCATATTGGCAAGGCCTGTGGCATCACTGCCATTTTG
CGCGGCATCCCCCTCCTCGCTGCTCGCCATCAGCCTGTCAAGACGCCCTCGGGCGCAGAAGCTCCCGTTACTCAC
CAACCCCATTTCCTCCTTCCCCTTGACGTCCTGGCCGAACAGGGCGTCAAGGAGGAGGAGGTGTTTCGCCAGGGC
CCTGACGCACATGGTCTTCAAGACGCTGTTTTTGCCGTTGCAACACGCGCCAACGACCACCTTTTGACGGCCAAG
GACATGTTGAAGCGACTAAAAGAGGGCCAAGACGCAGGGCACGAGTTTGAACACGGGCACGAGGCGGAGCACGTC
TACAGCGACACAGACGACTCGGCGCAACATGTGCGGCGCGGCTTTGGCGTCTTGCTAGAAGCCATATCTGCAGGC
CATCATCTCGAAAACCTGGAACGCGCCAACTTTGATCCCTTTGCAGTTCGGAGCGGCGGCTGGAGACTGCCGTGG
AAAATATGGCAAGCCCTGTCCAAAGAGCGGTTATGA
Gene >OphauG2|5320
ATGCATCGGCCACGACTGGTGCGCAGTGGCCTCAAAAGGCTCGCCTTTGCTCGCCCAAAATGTCGCCACCTCACC
ACGGACGCTGATGTCGATGCGGCCAGGAAATATTGCCTGGCCCGACTCTAGTCAGTCCGGGTGCTCGTGTCCCGC
CAAAGCGCGCCATGCCTGACTGCTGAACAGTAAAAGCGATTACGATGCCTACCTTGTCCGCCGCTTTGTCCCTCG
TCCTGTCCAGGACACCTATGCCGCTCTTCGCGCATTGAATCTCGAGCTTGTCCGGCTTCCAGATGTTATATCCAA
TCCAACCATTGGCGCCATGCGCATCGCCTTCTGGCAAGACTCAATAGACCAAACGTTTTCTGGCAAGCCCCCCCG
CGAGCCTATATGCCTACTCCTACACCACGGTCTGCAGGCGCTTCAAGCCAGAACCGGAAGCACAACCAAATCGTC
CGCCAAGTTTTGGATCTCGCGTCTCATCAAAACACGCGCCAAATACATGGATAACCGTCCTTTTCCCAGCATGGC
CAGCCTCGAAGACTATGCCGAAAACACTTACTCGTCCATCATGTACGCCACGCTGGCTGCCCTGCCGCTTCGCTC
CGTGCACATGGACCACTTGGCTAGCCATATTGGCAAGGCCTGTGGCATCACTGCCATTTTGCGCGGCATCCCCCT
CCTCGCTGCTCGCCATCAGCCTGTCAAGACGCCCTCGGGCGCAGAAGCTCCCGTTACTCACCAACCCCATTTCCT
CCTTCCCCTTGACGTCCTGGCCGAACAGGGCGTCAAGGAGGAGGAGGTGTTTCGCCAGGGCCCTGACGCACATGG
TCTTCAAGACGCTGTTTTTGCCGTTGCAACACGCGCCAACGACCACCTTTTGACGGCCAAGGACATGTTGAAGCG
ACTAAAAGAGGGCCAAGACGCAGGGCACGAGTTTGAACACGGGCACGAGGCGGAGCACGTCTACAGCGACACAGA
CGACTCGGCGCAACATGTGCGGCGCGGCTTTGGCGTCTTGCTAGAAGCCATATCTGCAGGCCATCATCTCGAAAA
CCTGGAACGCGCCAACTTTGATCCCTTTGCAGTTCGGAGCGGCGGCTGGAGACTGCCGTGGAAAATATGGCAAGC
CCTGTCCAAAGAGCGGTTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail