Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5317
Gene name
LocationContig_484:156..1728
Strand-
Gene length (bp)1572
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12738 PTCB-BRCT twin BRCT domain 6.0E-09 21 85
PF12738 PTCB-BRCT twin BRCT domain 4.3E-16 131 192
PF12738 PTCB-BRCT twin BRCT domain 2.2E-12 403 468
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 4.9E-09 17 88
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 7.8E-10 134 197
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 1.3E-05 402 470

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32372|RAD4_SCHPO S-M checkpoint control protein rad4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad4 PE=1 SV=2 12 471 2.0E-52
sp|Q6ZQF0|TOPB1_MOUSE DNA topoisomerase 2-binding protein 1 OS=Mus musculus GN=Topbp1 PE=1 SV=2 18 208 9.0E-24
sp|Q92547|TOPB1_HUMAN DNA topoisomerase 2-binding protein 1 OS=Homo sapiens GN=TOPBP1 PE=1 SV=3 18 253 2.0E-22
sp|Q800K6|TOB1A_XENLA DNA topoisomerase 2-binding protein 1-A OS=Xenopus laevis GN=topbp1-A PE=1 SV=2 21 278 2.0E-20
sp|Q7ZZY3|TOB1B_XENLA DNA topoisomerase 2-binding protein 1-B OS=Xenopus laevis GN=topbp1-B PE=2 SV=1 21 278 6.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32372|RAD4_SCHPO S-M checkpoint control protein rad4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad4 PE=1 SV=2 12 471 2.0E-52
sp|Q6ZQF0|TOPB1_MOUSE DNA topoisomerase 2-binding protein 1 OS=Mus musculus GN=Topbp1 PE=1 SV=2 18 208 9.0E-24
sp|Q92547|TOPB1_HUMAN DNA topoisomerase 2-binding protein 1 OS=Homo sapiens GN=TOPBP1 PE=1 SV=3 18 253 2.0E-22
sp|Q800K6|TOB1A_XENLA DNA topoisomerase 2-binding protein 1-A OS=Xenopus laevis GN=topbp1-A PE=1 SV=2 21 278 2.0E-20
sp|Q7ZZY3|TOB1B_XENLA DNA topoisomerase 2-binding protein 1-B OS=Xenopus laevis GN=topbp1-B PE=2 SV=1 21 278 6.0E-20
sp|Q92547|TOPB1_HUMAN DNA topoisomerase 2-binding protein 1 OS=Homo sapiens GN=TOPBP1 PE=1 SV=3 20 469 4.0E-08
sp|Q90WJ3|PAXI1_XENLA PAX-interacting protein 1 OS=Xenopus laevis GN=paxip1 PE=1 SV=1 35 212 5.0E-07
sp|Q6NZQ4|PAXI1_MOUSE PAX-interacting protein 1 OS=Mus musculus GN=Paxip1 PE=1 SV=1 35 212 2.0E-06
sp|A0JNA8|PAXI1_BOVIN PAX-interacting protein 1 OS=Bos taurus GN=PAXIP1 PE=2 SV=1 35 212 5.0E-06
sp|O04251|Y4211_ARATH BRCT domain-containing protein At4g02110 OS=Arabidopsis thaliana GN=At4g02110 PE=3 SV=3 20 209 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4499
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5317 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3801
Ophiocordyceps camponoti-floridani Ophcf2|01706
Ophiocordyceps camponoti-rufipedis Ophun1|6339
Ophiocordyceps kimflemingae Ophio5|4296
Ophiocordyceps subramaniannii Hirsu2|9382

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5317
MTPSPPPSEFGLDAAQPLHGVVVCCTSISPEQRSDIEAKVVELGGRHKQDLTLDATHLIVGDYDTPKYRHVARER
PDIKAMDAAWIYALSNHWKRDDEIDFAALEQTHRLQPLERGCVPASSQAPGQRLSLLICLTGFGDERSTIAQSIA
SSGGRHTGDLTRKCSHLIVCKPEGKKYQAAQNWKLHTVTLGWLHQSIARGMILDEARFDPLLPPHEQGVGATVPR
PVRTKRPRRDTPSGVDDGSRKLRKTASIKLKSQKSNLWDDILGETAAREPMPAADSRAQCLPPQPTTAQPPRPDY
AFAIAGFDDERHRRKLHDSILSLDGALVASPQDLLRSSAAHRLLVVPQTCPPDKVPPVPGPAIGLVTELYVETCL
HAKAFAPPGPGPVGRPFPCFPLAGLANLAICSAGFAGMELSQVARIVAQLGARYEEQMRRSTSLLVCKSLQAVRK
EKLRFALKWRIPVVSADWLWH*
Coding >OphauG2|5317
ATGACCCCATCACCACCACCCTCTGAATTCGGCTTGGATGCCGCCCAGCCCTTGCACGGCGTCGTCGTCTGCTGC
ACCAGCATCTCGCCAGAGCAACGCAGCGACATCGAGGCCAAGGTAGTAGAGCTGGGAGGCCGGCACAAGCAAGAC
TTGACCCTGGATGCCACGCACCTGATTGTCGGCGACTACGACACCCCAAAGTACCGCCATGTCGCGCGCGAACGC
CCCGACATCAAGGCCATGGATGCGGCCTGGATCTACGCCCTCTCCAACCACTGGAAGCGCGACGACGAAATCGAC
TTTGCCGCCCTCGAGCAGACTCACCGCCTCCAGCCGCTGGAACGAGGCTGCGTCCCTGCATCCTCCCAGGCTCCC
GGCCAGCGCCTCTCGCTGCTCATCTGCCTCACGGGCTTTGGCGACGAGCGAAGCACCATTGCCCAGAGCATCGCC
AGCAGCGGCGGCCGCCACACGGGCGACTTGACGCGCAAATGCTCCCACCTCATTGTCTGCAAGCCCGAGGGCAAG
AAATACCAGGCCGCGCAGAACTGGAAGCTGCACACGGTGACGCTTGGCTGGCTGCACCAGAGCATTGCCCGCGGC
ATGATTCTCGACGAGGCCAGGTTTGATCCGCTGCTGCCGCCGCACGAGCAGGGCGTGGGCGCCACTGTGCCGCGG
CCCGTCAGGACCAAGAGGCCGCGTCGAGACACGCCCAGCGGCGTCGACGACGGCTCCCGCAAGCTGCGCAAGACG
GCCAGCATCAAGCTCAAGTCGCAAAAGAGCAATCTGTGGGACGACATCTTGGGCGAGACGGCGGCGCGAGAGCCC
ATGCCTGCCGCCGACTCGAGAGCCCAATGCCTGCCGCCCCAGCCCACCACCGCCCAGCCGCCGCGCCCCGACTAC
GCCTTTGCCATTGCCGGCTTTGACGACGAGCGCCACCGACGCAAGCTGCACGACTCGATTCTCTCCCTCGACGGC
GCCCTCGTCGCCTCGCCTCAAGACTTGCTCCGGTCCTCGGCCGCCCATCGCCTGCTCGTCGTGCCGCAGACTTGC
CCGCCCGACAAGGTGCCGCCTGTGCCCGGGCCGGCCATTGGCCTCGTCACCGAGCTGTACGTCGAGACGTGTCTG
CACGCCAAAGCCTTTGCGCCTCCCGGGCCCGGCCCTGTTGGACGCCCGTTTCCCTGCTTCCCTCTTGCCGGGCTG
GCCAACCTGGCCATCTGCTCCGCGGGCTTTGCCGGCATGGAGCTCAGCCAGGTCGCTCGCATCGTGGCCCAGCTG
GGCGCCCGCTACGAGGAACAGATGCGCCGCTCAACAAGCCTCCTGGTCTGCAAGTCGCTGCAGGCGGTGCGCAAG
GAGAAGCTGCGCTTTGCCCTCAAGTGGCGCATCCCAGTCGTCTCGGCCGACTGGCTGTGGCACTGA
Transcript >OphauG2|5317
ATGACCCCATCACCACCACCCTCTGAATTCGGCTTGGATGCCGCCCAGCCCTTGCACGGCGTCGTCGTCTGCTGC
ACCAGCATCTCGCCAGAGCAACGCAGCGACATCGAGGCCAAGGTAGTAGAGCTGGGAGGCCGGCACAAGCAAGAC
TTGACCCTGGATGCCACGCACCTGATTGTCGGCGACTACGACACCCCAAAGTACCGCCATGTCGCGCGCGAACGC
CCCGACATCAAGGCCATGGATGCGGCCTGGATCTACGCCCTCTCCAACCACTGGAAGCGCGACGACGAAATCGAC
TTTGCCGCCCTCGAGCAGACTCACCGCCTCCAGCCGCTGGAACGAGGCTGCGTCCCTGCATCCTCCCAGGCTCCC
GGCCAGCGCCTCTCGCTGCTCATCTGCCTCACGGGCTTTGGCGACGAGCGAAGCACCATTGCCCAGAGCATCGCC
AGCAGCGGCGGCCGCCACACGGGCGACTTGACGCGCAAATGCTCCCACCTCATTGTCTGCAAGCCCGAGGGCAAG
AAATACCAGGCCGCGCAGAACTGGAAGCTGCACACGGTGACGCTTGGCTGGCTGCACCAGAGCATTGCCCGCGGC
ATGATTCTCGACGAGGCCAGGTTTGATCCGCTGCTGCCGCCGCACGAGCAGGGCGTGGGCGCCACTGTGCCGCGG
CCCGTCAGGACCAAGAGGCCGCGTCGAGACACGCCCAGCGGCGTCGACGACGGCTCCCGCAAGCTGCGCAAGACG
GCCAGCATCAAGCTCAAGTCGCAAAAGAGCAATCTGTGGGACGACATCTTGGGCGAGACGGCGGCGCGAGAGCCC
ATGCCTGCCGCCGACTCGAGAGCCCAATGCCTGCCGCCCCAGCCCACCACCGCCCAGCCGCCGCGCCCCGACTAC
GCCTTTGCCATTGCCGGCTTTGACGACGAGCGCCACCGACGCAAGCTGCACGACTCGATTCTCTCCCTCGACGGC
GCCCTCGTCGCCTCGCCTCAAGACTTGCTCCGGTCCTCGGCCGCCCATCGCCTGCTCGTCGTGCCGCAGACTTGC
CCGCCCGACAAGGTGCCGCCTGTGCCCGGGCCGGCCATTGGCCTCGTCACCGAGCTGTACGTCGAGACGTGTCTG
CACGCCAAAGCCTTTGCGCCTCCCGGGCCCGGCCCTGTTGGACGCCCGTTTCCCTGCTTCCCTCTTGCCGGGCTG
GCCAACCTGGCCATCTGCTCCGCGGGCTTTGCCGGCATGGAGCTCAGCCAGGTCGCTCGCATCGTGGCCCAGCTG
GGCGCCCGCTACGAGGAACAGATGCGCCGCTCAACAAGCCTCCTGGTCTGCAAGTCGCTGCAGGCGGTGCGCAAG
GAGAAGCTGCGCTTTGCCCTCAAGTGGCGCATCCCAGTCGTCTCGGCCGACTGGCTGTGGCACTGA
Gene >OphauG2|5317
ATGACCCCATCACCACCACCCTCTGAATTCGGCTTGGATGCCGCCCAGCCCTTGCACGGCGTCGTCGTCTGCTGC
ACCAGCATCTCGCCAGAGCAACGCGTACGTCTCGTCCCCCAAGACCCCTCCCGCGCAGCAGCAGCAGTCAAGCTT
ACCCAGACCCCCAAAAATGTCGAAAAAAAAAAAAATTGCAGAGCGACATCGAGGCCAAGGTAGTAGAGCTGGGAG
GCCGGCACAAGCAAGACTTGACCCTGGATGCCACGCACCTGATTGTCGGCGACTACGACACCCCAAAGTACCGCC
ATGTCGCGCGCGAACGCCCCGACATCAAGGCCATGGATGCGGCCTGGATCTACGCCCTCTCCAACCACTGGAAGC
GCGACGACGAAATCGACTTTGCCGCCCTCGAGCAGACTCACCGCCTCCAGCCGCTGGAACGAGGCTGCGTCCCTG
CATCCTCCCAGGCTCCCGGCCAGCGCCTCTCGCTGCTCATCTGCCTCACGGGCTTTGGCGACGAGCGAAGCACCA
TTGCCCAGAGCATCGCCAGCAGCGGCGGCCGCCACACGGGCGACTTGACGCGCAAATGCTCCCACCTCATTGTCT
GCAAGCCCGAGGGCAAGAAATACCAGGCCGCGCAGAACTGGAAGCTGCACACGGTGACGCTTGGCTGGCTGCACC
AGAGCATTGCCCGCGGCATGATTCTCGACGAGGCCAGGTTTGATCCGCTGCTGCCGCCGCACGAGCAGGGCGTGG
GCGCCACTGTGCCGCGGCCCGTCAGGACCAAGAGGCCGCGTCGAGACACGCCCAGCGGCGTCGACGACGGCTCCC
GCAAGCTGCGCAAGACGGCCAGCATCAAGCTCAAGTCGCAAAAGAGCAATCTGTGGGACGACATCTTGGGCGAGA
CGGCGGCGCGAGAGCCCATGCCTGCCGCCGACTCGAGAGCCCAATGCCTGCCGCCCCAGCCCACCACCGCCCAGC
CGCCGCGCCCCGACTACGCCTTTGCCATTGCCGGCTTTGACGACGAGCGCCACCGACGCAAGCTGCACGACTCGA
TTCTCTCCCTCGACGGCGCCCTCGTCGCCTCGCCTCAAGACTTGCTCCGGTCCTCGGCCGCCCATCGCCTGCTCG
TCGTGCCGCAGACTTGCCCGCCCGACAAGGTGCCGCCTGTGCCCGGGCCGGCCATTGGCCTCGTCACCGAGCTGT
ACGTCGAGACGTGTCTGCACGCCAAAGCCTTTGCGCCTCCCGGGCCCGGCCCTGTTGGACGCCCGTTTCCCTGCT
TCCCTCTTGCCGGGCTGGCCAACCTGGCCATCTGCTCCGCGGGCTTTGCCGGCATGGAGCTCAGCCAGGTCGCTC
GCATCGTGGCCCAGCTGGGCGCCCGCTACGAGGAACAGATGCGCCGCTCAACAAGCCTCCTGGTCTGCAAGTCGC
TGCAGGCGGTGCGCAAGGAGAAGCTGCGCTTTGCCCTCAAGTGGCGCATCCCAGTCGTCTCGGCCGACTGGCTGT
GGCAGTGCATTTCCACCGGCACCAGTCTTGCCCACGACGGCTTTGTCTTTGCCGAGCTGCGCGACAAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail