Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5313
Gene name
LocationContig_483:3786..5389
Strand+
Gene length (bp)1603
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01156 IU_nuc_hydro Inosine-uridine preferring nucleoside hydrolase 4.8E-57 6 383

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J4|YHD6_SCHPO Uncharacterized protein C1683.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.06c PE=3 SV=1 5 365 2.0E-25
sp|C0PW90|RIHA_SALPC Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella paratyphi C (strain RKS4594) GN=rihA PE=3 SV=1 6 365 1.0E-23
sp|Q8Z8H0|RIHA_SALTI Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella typhi GN=rihA PE=3 SV=1 6 365 1.0E-23
sp|A9MUJ0|RIHA_SALPB Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rihA PE=3 SV=1 6 365 1.0E-23
sp|Q57RR6|RIHA_SALCH Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella choleraesuis (strain SC-B67) GN=rihA PE=3 SV=1 6 365 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J4|YHD6_SCHPO Uncharacterized protein C1683.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.06c PE=3 SV=1 5 365 2.0E-25
sp|C0PW90|RIHA_SALPC Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella paratyphi C (strain RKS4594) GN=rihA PE=3 SV=1 6 365 1.0E-23
sp|Q8Z8H0|RIHA_SALTI Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella typhi GN=rihA PE=3 SV=1 6 365 1.0E-23
sp|A9MUJ0|RIHA_SALPB Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rihA PE=3 SV=1 6 365 1.0E-23
sp|Q57RR6|RIHA_SALCH Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella choleraesuis (strain SC-B67) GN=rihA PE=3 SV=1 6 365 1.0E-22
sp|B5R809|RIHA_SALG2 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rihA PE=3 SV=1 6 365 4.0E-22
sp|B5QVR2|RIHA_SALEP Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella enteritidis PT4 (strain P125109) GN=rihA PE=3 SV=1 6 365 5.0E-22
sp|Q6ZJ05|URH1_ORYSJ Probable uridine nucleosidase 1 OS=Oryza sativa subsp. japonica GN=URH1 PE=2 SV=1 5 358 5.0E-22
sp|B5XWV7|RIHA_KLEP3 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Klebsiella pneumoniae (strain 342) GN=rihA PE=3 SV=1 6 365 6.0E-22
sp|B4SYM0|RIHA_SALNS Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella newport (strain SL254) GN=rihA PE=3 SV=1 6 365 7.0E-22
sp|Q8ZQY4|RIHA_SALTY Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rihA PE=3 SV=1 6 365 8.0E-22
sp|B5EZA2|RIHA_SALA4 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella agona (strain SL483) GN=rihA PE=3 SV=1 6 365 9.0E-22
sp|B4TB65|RIHA_SALHS Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella heidelberg (strain SL476) GN=rihA PE=3 SV=1 6 365 9.0E-22
sp|A6T9S2|RIHA_KLEP7 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rihA PE=3 SV=1 6 365 1.0E-21
sp|B4TPY1|RIHA_SALSV Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella schwarzengrund (strain CVM19633) GN=rihA PE=3 SV=1 6 365 1.0E-21
sp|B5FNA2|RIHA_SALDC Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella dublin (strain CT_02021853) GN=rihA PE=3 SV=1 6 365 2.0E-21
sp|B5BCD9|RIHA_SALPK Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella paratyphi A (strain AKU_12601) GN=rihA PE=3 SV=1 6 365 3.0E-21
sp|Q5PM78|RIHA_SALPA Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rihA PE=3 SV=1 6 365 3.0E-21
sp|B5Y231|RIHC_KLEP3 Non-specific ribonucleoside hydrolase RihC OS=Klebsiella pneumoniae (strain 342) GN=rihC PE=3 SV=1 6 382 7.0E-21
sp|A9MKC6|RIHA_SALAR Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rihA PE=3 SV=1 6 365 9.0E-21
sp|A8AJF8|RIHA_CITK8 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rihA PE=3 SV=1 6 365 2.0E-20
sp|A6T4G4|RIHC_KLEP7 Non-specific ribonucleoside hydrolase RihC OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rihC PE=3 SV=1 6 382 4.0E-20
sp|Q8LAC4|URH2_ARATH Probable uridine nucleosidase 2 OS=Arabidopsis thaliana GN=URH2 PE=2 SV=1 5 228 8.0E-20
sp|Q9SJM7|URH1_ARATH Uridine nucleosidase 1 OS=Arabidopsis thaliana GN=URH1 PE=1 SV=2 5 228 1.0E-19
sp|A4W829|RIHA_ENT38 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Enterobacter sp. (strain 638) GN=rihA PE=3 SV=1 6 365 2.0E-19
sp|P41409|RIHA_ECOLI Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain K12) GN=rihA PE=1 SV=2 6 365 2.0E-19
sp|C4ZWD8|RIHA_ECOBW Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rihA PE=3 SV=1 6 365 2.0E-19
sp|B1IYF7|RIHA_ECOLC Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rihA PE=3 SV=1 6 365 3.0E-19
sp|B1LLA1|RIHA_ECOSM Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rihA PE=3 SV=1 6 365 3.0E-19
sp|B1KHA5|RIHA_SHEWM Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rihA PE=3 SV=1 6 366 3.0E-19
sp|B7N9Q7|RIHA_ECOLU Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rihA PE=3 SV=1 6 365 3.0E-19
sp|B5YQK2|RIHA_ECO5E Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rihA PE=3 SV=1 6 365 4.0E-19
sp|Q8XBL8|RIHA_ECO57 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O157:H7 GN=rihA PE=3 SV=1 6 365 4.0E-19
sp|Q83LY1|RIHA_SHIFL Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shigella flexneri GN=rihA PE=3 SV=4 6 365 4.0E-19
sp|Q0T6R1|RIHA_SHIF8 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shigella flexneri serotype 5b (strain 8401) GN=rihA PE=3 SV=1 6 365 4.0E-19
sp|B6I163|RIHA_ECOSE Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain SE11) GN=rihA PE=3 SV=1 6 365 4.0E-19
sp|B7L9J7|RIHA_ECO55 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain 55989 / EAEC) GN=rihA PE=3 SV=1 6 365 4.0E-19
sp|A7ZJ42|RIHA_ECO24 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rihA PE=3 SV=1 6 365 4.0E-19
sp|Q324P5|RIHA_SHIBS Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shigella boydii serotype 4 (strain Sb227) GN=rihA PE=3 SV=1 6 365 4.0E-19
sp|B2TU69|RIHA_SHIB3 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rihA PE=3 SV=1 6 365 5.0E-19
sp|B7LKV4|RIHA_ESCF3 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rihA PE=3 SV=1 6 365 6.0E-19
sp|B7NM03|RIHA_ECO7I Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rihA PE=3 SV=1 6 365 8.0E-19
sp|A7ZXS0|RIHA_ECOHS Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O9:H4 (strain HS) GN=rihA PE=3 SV=1 6 365 8.0E-19
sp|Q0TK29|RIHA_ECOL5 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rihA PE=3 SV=1 6 365 9.0E-19
sp|B7MRT1|RIHA_ECO81 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O81 (strain ED1a) GN=rihA PE=3 SV=1 6 365 9.0E-19
sp|B1LFW0|RIHC_ECOSM Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rihC PE=3 SV=1 6 382 9.0E-19
sp|Q3Z4E1|RIHA_SHISS Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shigella sonnei (strain Ss046) GN=rihA PE=3 SV=1 6 365 1.0E-18
sp|B7M5H8|RIHA_ECO8A Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O8 (strain IAI1) GN=rihA PE=3 SV=1 6 365 1.0E-18
sp|B4TWP3|RIHC_SALSV Non-specific ribonucleoside hydrolase RihC OS=Salmonella schwarzengrund (strain CVM19633) GN=rihC PE=3 SV=1 2 382 1.0E-18
sp|Q8FJY8|RIHA_ECOL6 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rihA PE=3 SV=2 6 365 2.0E-18
sp|A1A8R9|RIHA_ECOK1 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O1:K1 / APEC GN=rihA PE=3 SV=1 6 365 2.0E-18
sp|B7MFR7|RIHA_ECO45 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rihA PE=3 SV=1 6 365 2.0E-18
sp|B7UKT4|RIHA_ECO27 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rihA PE=3 SV=1 6 365 2.0E-18
sp|A0L0Y0|RIHA_SHESA Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella sp. (strain ANA-3) GN=rihA PE=3 SV=1 6 382 2.0E-18
sp|Q0HZ05|RIHA_SHESR Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella sp. (strain MR-7) GN=rihA PE=3 SV=1 6 382 2.0E-18
sp|Q652Q8|URH2_ORYSJ Probable uridine nucleosidase 2 OS=Oryza sativa subsp. japonica GN=URH2 PE=2 SV=1 5 228 3.0E-18
sp|Q8EIM7|RIHA_SHEON Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella oneidensis (strain MR-1) GN=rihA PE=3 SV=1 4 375 3.0E-18
sp|B5F731|RIHC_SALA4 Non-specific ribonucleoside hydrolase RihC OS=Salmonella agona (strain SL483) GN=rihC PE=3 SV=1 2 382 6.0E-18
sp|Q6LQG2|RIHA_PHOPR Pyrimidine-specific ribonucleoside hydrolase RihA OS=Photobacterium profundum GN=rihA PE=3 SV=1 6 366 8.0E-18
sp|B4TIF1|RIHC_SALHS Non-specific ribonucleoside hydrolase RihC OS=Salmonella heidelberg (strain SL476) GN=rihC PE=3 SV=1 2 382 1.0E-17
sp|Q8ZRY7|RIHC_SALTY Non-specific ribonucleoside hydrolase RihC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rihC PE=3 SV=1 2 382 1.0E-17
sp|B4T6H8|RIHC_SALNS Non-specific ribonucleoside hydrolase RihC OS=Salmonella newport (strain SL254) GN=rihC PE=3 SV=1 2 382 1.0E-17
sp|B5FHE5|RIHC_SALDC Non-specific ribonucleoside hydrolase RihC OS=Salmonella dublin (strain CT_02021853) GN=rihC PE=3 SV=1 2 382 1.0E-17
sp|Q0HEZ4|RIHA_SHESM Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella sp. (strain MR-4) GN=rihA PE=3 SV=1 6 382 1.0E-17
sp|B5BLL5|RIHC_SALPK Non-specific ribonucleoside hydrolase RihC OS=Salmonella paratyphi A (strain AKU_12601) GN=rihC PE=3 SV=1 2 382 3.0E-17
sp|Q5PKI2|RIHC_SALPA Non-specific ribonucleoside hydrolase RihC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rihC PE=3 SV=1 2 382 3.0E-17
sp|A9MYH1|RIHC_SALPB Non-specific ribonucleoside hydrolase RihC OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rihC PE=3 SV=1 2 382 3.0E-17
sp|Q8Z9M9|RIHC_SALTI Non-specific ribonucleoside hydrolase RihC OS=Salmonella typhi GN=rihC PE=3 SV=1 2 382 4.0E-17
sp|C0Q4J2|RIHC_SALPC Non-specific ribonucleoside hydrolase RihC OS=Salmonella paratyphi C (strain RKS4594) GN=rihC PE=3 SV=1 2 382 4.0E-17
sp|Q57TL0|RIHC_SALCH Non-specific ribonucleoside hydrolase RihC OS=Salmonella choleraesuis (strain SC-B67) GN=rihC PE=3 SV=1 2 382 4.0E-17
sp|B7LVN6|RIHC_ESCF3 Non-specific ribonucleoside hydrolase RihC OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rihC PE=3 SV=1 6 382 5.0E-17
sp|B5RG86|RIHC_SALG2 Non-specific ribonucleoside hydrolase RihC OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rihC PE=3 SV=1 2 382 5.0E-17
sp|B5R1P1|RIHC_SALEP Non-specific ribonucleoside hydrolase RihC OS=Salmonella enteritidis PT4 (strain P125109) GN=rihC PE=3 SV=1 2 382 5.0E-17
sp|Q326J3|RIHC_SHIBS Non-specific ribonucleoside hydrolase RihC OS=Shigella boydii serotype 4 (strain Sb227) GN=rihC PE=3 SV=1 6 382 5.0E-17
sp|P0C0W2|RIHC_ECOL6 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rihC PE=3 SV=1 6 382 6.0E-17
sp|A7ZHB9|RIHC_ECO24 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rihC PE=3 SV=1 6 382 7.0E-17
sp|Q32K67|RIHC_SHIDS Non-specific ribonucleoside hydrolase RihC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rihC PE=3 SV=1 6 382 8.0E-17
sp|B2U249|RIHC_SHIB3 Non-specific ribonucleoside hydrolase RihC OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rihC PE=3 SV=1 6 382 1.0E-16
sp|P22564|RIHC_ECOLI Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain K12) GN=rihC PE=1 SV=1 6 382 1.0E-16
sp|B1XBF5|RIHC_ECODH Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain K12 / DH10B) GN=rihC PE=3 SV=1 6 382 1.0E-16
sp|C4ZPV6|RIHC_ECOBW Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rihC PE=3 SV=1 6 382 1.0E-16
sp|B7L4F2|RIHC_ECO55 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain 55989 / EAEC) GN=rihC PE=3 SV=1 6 382 1.0E-16
sp|A7ZVX8|RIHC_ECOHS Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O9:H4 (strain HS) GN=rihC PE=3 SV=1 6 382 2.0E-16
sp|B7M0C6|RIHC_ECO8A Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O8 (strain IAI1) GN=rihC PE=3 SV=1 6 382 2.0E-16
sp|A3D0C6|RIHA_SHEB5 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rihA PE=3 SV=1 6 382 2.0E-16
sp|Q3Z5Y0|RIHC_SHISS Non-specific ribonucleoside hydrolase RihC OS=Shigella sonnei (strain Ss046) GN=rihC PE=3 SV=1 6 382 2.0E-16
sp|B6HYX8|RIHC_ECOSE Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain SE11) GN=rihC PE=3 SV=1 6 382 2.0E-16
sp|Q1RGH2|RIHC_ECOUT Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain UTI89 / UPEC) GN=rihC PE=3 SV=1 6 382 2.0E-16
sp|A1A778|RIHC_ECOK1 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O1:K1 / APEC GN=rihC PE=3 SV=1 6 382 2.0E-16
sp|B7MNN5|RIHC_ECO81 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O81 (strain ED1a) GN=rihC PE=3 SV=1 6 382 2.0E-16
sp|B7MAF0|RIHC_ECO45 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rihC PE=3 SV=1 6 382 2.0E-16
sp|B5YYC2|RIHC_ECO5E Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rihC PE=3 SV=1 6 382 4.0E-16
sp|Q8XA41|RIHC_ECO57 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O157:H7 GN=rihC PE=3 SV=1 6 382 4.0E-16
sp|B7N7Q4|RIHC_ECOLU Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rihC PE=3 SV=1 6 382 5.0E-16
sp|B7NHD4|RIHC_ECO7I Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rihC PE=3 SV=1 6 382 5.0E-16
sp|A6WSI3|RIHA_SHEB8 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella baltica (strain OS185) GN=rihA PE=3 SV=1 6 382 5.0E-16
sp|Q0TLW1|RIHC_ECOL5 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rihC PE=3 SV=1 6 382 7.0E-16
sp|Q83MH0|RIHC_SHIFL Non-specific ribonucleoside hydrolase RihC OS=Shigella flexneri GN=rihC PE=3 SV=1 6 382 1.0E-15
sp|Q0T8G4|RIHC_SHIF8 Non-specific ribonucleoside hydrolase RihC OS=Shigella flexneri serotype 5b (strain 8401) GN=rihC PE=3 SV=1 6 382 1.0E-15
sp|B7UI75|RIHC_ECO27 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rihC PE=3 SV=1 6 382 2.0E-15
sp|P83851|IUNH_LEIMA Inosine-uridine preferring nucleoside hydrolase OS=Leishmania major GN=NSNH PE=1 SV=3 3 382 3.0E-15
sp|Q27546|IUNH_CRIFA Inosine-uridine preferring nucleoside hydrolase OS=Crithidia fasciculata GN=IUNH PE=1 SV=3 3 367 4.0E-15
sp|B1LKQ9|RIHB_ECOSM Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rihB PE=3 SV=1 5 382 2.0E-14
sp|B7NMX6|RIHB_ECO7I Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rihB PE=3 SV=1 5 382 2.0E-14
sp|B7LAI5|RIHB_ECO55 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain 55989 / EAEC) GN=rihB PE=3 SV=1 5 382 2.0E-14
sp|B1IYA8|RIHB_ECOLC Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rihB PE=3 SV=1 5 382 3.0E-14
sp|A8A225|RIHB_ECOHS Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O9:H4 (strain HS) GN=rihB PE=3 SV=1 5 382 3.0E-14
sp|B7M510|RIHB_ECO8A Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O8 (strain IAI1) GN=rihB PE=3 SV=1 5 382 3.0E-14
sp|Q3Z044|RIHB_SHISS Pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella sonnei (strain Ss046) GN=rihB PE=3 SV=1 5 382 7.0E-14
sp|P33022|RIHB_ECOLI Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain K12) GN=rihB PE=1 SV=1 5 382 7.0E-14
sp|B1X860|RIHB_ECODH Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain K12 / DH10B) GN=rihB PE=3 SV=1 5 382 7.0E-14
sp|C4ZU12|RIHB_ECOBW Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rihB PE=3 SV=1 5 382 7.0E-14
sp|A7ZNY5|RIHB_ECO24 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rihB PE=3 SV=1 5 382 7.0E-14
sp|B7LVC3|RIHB_ESCF3 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rihB PE=3 SV=1 5 382 1.0E-13
sp|Q1R9R0|RIHB_ECOUT Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain UTI89 / UPEC) GN=rihB PE=3 SV=1 5 382 1.0E-13
sp|Q8FFT8|RIHB_ECOL6 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rihB PE=3 SV=1 5 382 1.0E-13
sp|Q0TFS8|RIHB_ECOL5 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rihB PE=3 SV=1 5 382 1.0E-13
sp|A1AD20|RIHB_ECOK1 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O1:K1 / APEC GN=rihB PE=3 SV=1 5 382 1.0E-13
sp|B7MX26|RIHB_ECO81 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O81 (strain ED1a) GN=rihB PE=3 SV=1 5 382 1.0E-13
sp|B7MF76|RIHB_ECO45 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rihB PE=3 SV=1 5 382 1.0E-13
sp|B7UFH8|RIHB_ECO27 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rihB PE=3 SV=1 5 382 1.0E-13
sp|B5YWV3|RIHB_ECO5E Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rihB PE=3 SV=1 5 382 2.0E-13
sp|Q8XE94|RIHB_ECO57 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O157:H7 GN=rihB PE=3 SV=1 5 382 2.0E-13
sp|Q83KF1|RIHB_SHIFL Pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella flexneri GN=rihB PE=3 SV=1 5 382 2.0E-13
sp|Q0T2W2|RIHB_SHIF8 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella flexneri serotype 5b (strain 8401) GN=rihB PE=3 SV=1 5 382 2.0E-13
sp|Q10314|YD62_SCHPO Uncharacterized protein C17G8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.02 PE=3 SV=1 8 242 3.0E-13
sp|B7N5C5|RIHB_ECOLU Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rihB PE=3 SV=1 5 382 4.0E-13
sp|B6I8L3|RIHB_ECOSE Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain SE11) GN=rihB PE=3 SV=1 5 382 7.0E-13
sp|P32986|YBP2_ACIAM Uncharacterized protein in bps2 5'region (Fragment) OS=Acidianus ambivalens PE=3 SV=1 3 224 2.0E-12
sp|Q32ER0|RIHB_SHIDS Putative pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rihB PE=3 SV=1 78 382 2.0E-09
sp|Q31YW9|RIHB_SHIBS Putative pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella boydii serotype 4 (strain Sb227) GN=rihB PE=3 SV=1 168 382 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4709
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5313 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3969
Ophiocordyceps camponoti-floridani Ophcf2|00276
Ophiocordyceps camponoti-rufipedis Ophun1|4290
Ophiocordyceps kimflemingae Ophio5|8152
Ophiocordyceps subramaniannii Hirsu2|9909

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5313
MAPCKVIIDTDPGVDDIMAMLLALSASSDELEVAMLSITYGNVPLKCCLRNAVALFHVLEKELAWRRTSGRPEGY
ACLKMKKPIVAMGPEHPLEEEELMADYFHGEDGLHNVHRAHPHLSPADTWHSLFDANGDLAGETTPPSLFTPSSR
PSHLEMLRILAENPVDTVSILALGPLTNVALAAAEDPETFLRAKELVVMGGAIDVEGNVTPVAEFNGYADSVAAA
RVYALTSPTPSSTMPPLSPHLSSSSAYPSKLWRPLRLVLAPLDVTTPHLITRDYFAQRVQPLVDAGSPLAQWTAH
FINGTFNKIEEMLGDGNEPGLSLHDPLTVWYVLTKEDPGWKFPAKPEDIRVETSGQWTRGMHVVDRRTRAKPAEA
AAAASVDPHEDANIVSLDQVPGDTMGWLSVLKGNRIHRIIATPGQDVFKQVWMDRVFCPS*
Coding >OphauG2|5313
ATGGCTCCTTGCAAAGTAATCATTGACACGGATCCAGGTGTCGACGACATCATGGCCATGCTGCTTGCCCTGAGC
GCCTCTTCCGATGAACTCGAGGTAGCCATGCTGTCTATTACGTACGGCAACGTTCCTCTAAAGTGCTGTCTTCGC
AACGCTGTCGCTCTTTTCCATGTCTTGGAAAAGGAATTGGCTTGGAGACGAACCTCTGGCCGTCCCGAGGGCTAT
GCTTGTCTCAAGATGAAGAAGCCCATTGTTGCCATGGGGCCTGAGCATCCGCTCGAGGAAGAGGAGCTCATGGCT
GACTATTTTCATGGCGAGGATGGGTTGCACAATGTCCACCGTGCGCATCCTCACCTCAGCCCTGCAGATACGTGG
CATTCACTCTTTGACGCCAATGGAGACTTGGCTGGCGAGACGACGCCCCCCTCGCTCTTCACCCCGTCATCGCGG
CCCTCTCATTTGGAGATGCTGCGCATCCTTGCTGAAAACCCCGTCGACACAGTCTCCATTCTCGCTCTCGGCCCC
CTGACCAATGTCGCCCTGGCTGCCGCCGAGGATCCCGAAACCTTTCTCCGCGCAAAGGAGCTCGTCGTCATGGGC
GGCGCCATTGACGTCGAAGGCAATGTCACCCCCGTCGCCGAGTTCAACGGCTATGCTGACTCGGTGGCTGCTGCG
CGTGTCTACGCCCTCACCTCCCCCACCCCATCCTCCACCATGCCCCCCTTGTCGCCACACCTGTCCTCCTCGTCC
GCTTACCCTAGCAAGCTTTGGCGTCCGTTGCGCTTGGTTCTTGCCCCCCTCGACGTCACCACTCCCCATCTCATC
ACTCGAGACTACTTTGCCCAGCGTGTCCAGCCCCTTGTTGACGCTGGCAGCCCTCTGGCTCAGTGGACGGCTCAC
TTCATCAATGGAACATTCAACAAGATTGAGGAGATGCTGGGAGACGGCAACGAACCAGGCTTGTCTTTGCACGAT
CCGCTGACTGTCTGGTACGTCTTGACCAAAGAGGACCCCGGTTGGAAGTTCCCCGCCAAGCCAGAGGACATTCGT
GTCGAGACGTCGGGTCAATGGACTCGCGGCATGCACGTTGTCGATAGACGCACAAGAGCCAAGCCTGCAGAGGCT
GCTGCCGCCGCCTCGGTAGATCCCCATGAGGATGCCAACATAGTCTCATTGGATCAAGTGCCTGGCGATACCATG
GGCTGGCTTAGCGTCCTCAAGGGCAATCGTATCCATCGCATAATTGCGACTCCTGGTCAAGATGTCTTTAAGCAA
GTCTGGATGGACCGCGTCTTTTGCCCAAGCTGA
Transcript >OphauG2|5313
ATGGCTCCTTGCAAAGTAATCATTGACACGGATCCAGGTGTCGACGACATCATGGCCATGCTGCTTGCCCTGAGC
GCCTCTTCCGATGAACTCGAGGTAGCCATGCTGTCTATTACGTACGGCAACGTTCCTCTAAAGTGCTGTCTTCGC
AACGCTGTCGCTCTTTTCCATGTCTTGGAAAAGGAATTGGCTTGGAGACGAACCTCTGGCCGTCCCGAGGGCTAT
GCTTGTCTCAAGATGAAGAAGCCCATTGTTGCCATGGGGCCTGAGCATCCGCTCGAGGAAGAGGAGCTCATGGCT
GACTATTTTCATGGCGAGGATGGGTTGCACAATGTCCACCGTGCGCATCCTCACCTCAGCCCTGCAGATACGTGG
CATTCACTCTTTGACGCCAATGGAGACTTGGCTGGCGAGACGACGCCCCCCTCGCTCTTCACCCCGTCATCGCGG
CCCTCTCATTTGGAGATGCTGCGCATCCTTGCTGAAAACCCCGTCGACACAGTCTCCATTCTCGCTCTCGGCCCC
CTGACCAATGTCGCCCTGGCTGCCGCCGAGGATCCCGAAACCTTTCTCCGCGCAAAGGAGCTCGTCGTCATGGGC
GGCGCCATTGACGTCGAAGGCAATGTCACCCCCGTCGCCGAGTTCAACGGCTATGCTGACTCGGTGGCTGCTGCG
CGTGTCTACGCCCTCACCTCCCCCACCCCATCCTCCACCATGCCCCCCTTGTCGCCACACCTGTCCTCCTCGTCC
GCTTACCCTAGCAAGCTTTGGCGTCCGTTGCGCTTGGTTCTTGCCCCCCTCGACGTCACCACTCCCCATCTCATC
ACTCGAGACTACTTTGCCCAGCGTGTCCAGCCCCTTGTTGACGCTGGCAGCCCTCTGGCTCAGTGGACGGCTCAC
TTCATCAATGGAACATTCAACAAGATTGAGGAGATGCTGGGAGACGGCAACGAACCAGGCTTGTCTTTGCACGAT
CCGCTGACTGTCTGGTACGTCTTGACCAAAGAGGACCCCGGTTGGAAGTTCCCCGCCAAGCCAGAGGACATTCGT
GTCGAGACGTCGGGTCAATGGACTCGCGGCATGCACGTTGTCGATAGACGCACAAGAGCCAAGCCTGCAGAGGCT
GCTGCCGCCGCCTCGGTAGATCCCCATGAGGATGCCAACATAGTCTCATTGGATCAAGTGCCTGGCGATACCATG
GGCTGGCTTAGCGTCCTCAAGGGCAATCGTATCCATCGCATAATTGCGACTCCTGGTCAAGATGTCTTTAAGCAA
GTCTGGATGGACCGCGTCTTTTGCCCAAGCTGA
Gene >OphauG2|5313
ATGGCTCCTTGCAAAGTAATCATTGACACGGATCCAGGTTCGCAGCTACAACTTGTACAGAAAAAAAAAAAACCA
TAACCCGCTGACTCGTAAGCTGCAGGTGTCGACGACATCATGGCCATGCTGCTTGCCCTGAGCGCCTCTTCCGAT
GAACTCGAGGTAGCCATGCTGTCTATTACGTACGGCAACGTTCCTCTAAAGTGGTGCGTTGCCCAGAAACAAAAA
AAACAAGAAGAAGAAAAAAAAACCGTCGCCTACTTTGATATCCCCCATTGACCAGAACCTACCCCCATCTTGCCC
TTTTTTCTCCCTTTGTAGCTGTCTTCGCAACGCTGTCGCTCTTTTCCATGTCTTGGAAAAGGAATTGGCTTGGAG
ACGAACCTCTGGCCGTCCCGAGGGCTATGCTTGTCTCAAGATGAAGAAGCCCATTGTTGCCATGGGGCCTGAGCA
TCCGCTCGAGGAAGAGGAGCTCATGGCTGACTATTTTCGTAAGTTTGCATCATGCTGTGCCCCAAAACAGAAAAA
AAAAAAAAAAAACTTTTTCCATGCGCTTACAAGGAGCCTTGGAGCAACGGGCTAATACTTTTCTTGTCTGCTGCT
GCAAGATGGCGAGGATGGGTTGCACAATGTCCACCGTGCGCATCCTCACCTCAGCCCTGCAGATACGTGGCATTC
ACTCTTTGACGCCAATGGAGACTTGGCTGGCGAGACGACGCCCCCCTCGCTCTTCACCCCGTCATCGCGGCCCTC
TCATTTGGAGATGCTGCGCATCCTTGCTGAAAACCCCGTCGACACAGTCTCCATTCTCGCTCTCGGCCCCCTGAC
CAATGTCGCCCTGGCTGCCGCCGAGGATCCCGAAACCTTTCTCCGCGCAAAGGAGCTCGTCGTCATGGGCGGCGC
CATTGACGTCGAAGGCAATGTCACCCCCGTCGCCGAGTTCAACGGCTATGCTGACTCGGTGGCTGCTGCGCGTGT
CTACGCCCTCACCTCCCCCACCCCATCCTCCACCATGCCCCCCTTGTCGCCACACCTGTCCTCCTCGTCCGCTTA
CCCTAGCAAGCTTTGGCGTCCGTTGCGCTTGGTTCTTGCCCCCCTCGACGTCACCACTCCCCATCTCATCACTCG
AGACTACTTTGCCCAGCGTGTCCAGCCCCTTGTTGACGCTGGCAGCCCTCTGGCTCAGTGGACGGCTCACTTCAT
CAATGGAACATTCAACAAGATTGAGGAGATGCTGGGAGACGGCAACGAACCAGGCTTGTCTTTGCACGATCCGCT
GACTGTCTGGTACGTCTTGACCAAAGAGGACCCCGGTTGGAAGTTCCCCGCCAAGCCAGAGGACATTCGTGTCGA
GACGTCGGGTCAATGGACTCGCGGCATGCACGTTGTCGATAGACGCACAAGAGCCAAGCCTGCAGAGGCTGCTGC
CGCCGCCTCGGTAGATCCCCATGAGGATGCCAACATAGTCTCATTGGATCAAGTGCCTGGCGATACCATGGGCTG
GCTTAGCGTCCTCAAGGGCAATCGTATCCATCGCATAATTGCGACTCCTGGTCAAGATGTCTTTAAGCAAGTCTG
GATGGACCGCGTCTTTTGCCCAAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail