Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5306
Gene name
LocationContig_482:2468..3807
Strand-
Gene length (bp)1339
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00735 Septin Septin 7.1E-119 31 309
PF01926 MMR_HSR1 50S ribosome-binding GTPase 4.1E-08 36 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39826|CDC3_CANAX Cell division control protein 3 OS=Candida albicans GN=CDC3 PE=3 SV=1 6 395 1.0E-172
sp|O36023|SPN1_SCHPO Septin homolog spn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn1 PE=1 SV=2 5 404 9.0E-169
sp|P32457|CDC3_YEAST Cell division control protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC3 PE=1 SV=3 6 390 2.0E-146
sp|Q5R481|SEPT7_PONAB Septin-7 OS=Pongo abelii GN=SEPT7 PE=2 SV=2 8 390 1.0E-130
sp|Q16181|SEPT7_HUMAN Septin-7 OS=Homo sapiens GN=SEPT7 PE=1 SV=2 8 390 1.0E-130
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39826|CDC3_CANAX Cell division control protein 3 OS=Candida albicans GN=CDC3 PE=3 SV=1 6 395 1.0E-172
sp|O36023|SPN1_SCHPO Septin homolog spn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn1 PE=1 SV=2 5 404 9.0E-169
sp|P32457|CDC3_YEAST Cell division control protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC3 PE=1 SV=3 6 390 2.0E-146
sp|Q5R481|SEPT7_PONAB Septin-7 OS=Pongo abelii GN=SEPT7 PE=2 SV=2 8 390 1.0E-130
sp|Q16181|SEPT7_HUMAN Septin-7 OS=Homo sapiens GN=SEPT7 PE=1 SV=2 8 390 1.0E-130
sp|Q6Q137|SEPT7_BOVIN Septin-7 OS=Bos taurus GN=SEPT7 PE=2 SV=2 8 390 1.0E-130
sp|Q9WVC0|SEPT7_RAT Septin-7 OS=Rattus norvegicus GN=Sept7 PE=1 SV=1 9 390 2.0E-130
sp|O55131|SEPT7_MOUSE Septin-7 OS=Mus musculus GN=Sept7 PE=1 SV=1 9 390 2.0E-130
sp|Q5R1W1|SEPT7_PANTR Septin-7 (Fragment) OS=Pan troglodytes GN=SEPT7 PE=2 SV=2 8 390 1.0E-129
sp|Q6GLZ5|SEPT7_XENLA Septin-7 OS=Xenopus laevis GN=sept7 PE=2 SV=1 8 390 7.0E-129
sp|P40797|PNUT_DROME Protein peanut OS=Drosophila melanogaster GN=pnut PE=1 SV=2 7 378 9.0E-128
sp|P42207|SEPT1_DROME Septin-1 OS=Drosophila melanogaster GN=Sep1 PE=1 SV=1 2 308 7.0E-112
sp|Q5ZMH1|SEPT2_CHICK Septin-2 OS=Gallus gallus GN=SEPT2 PE=2 SV=1 12 344 4.0E-111
sp|Q5BKN4|SEP2A_XENTR Septin-2A OS=Xenopus tropicalis GN=sept2-A PE=2 SV=1 12 344 7.0E-111
sp|A1L0Y5|SEP2B_XENTR Septin-2B OS=Xenopus tropicalis GN=sept2-B PE=2 SV=1 13 352 2.0E-110
sp|Q9DE33|SEP2A_XENLA Septin-2A OS=Xenopus laevis GN=sept2-a PE=1 SV=1 13 352 9.0E-110
sp|Q63ZQ1|SEP2B_XENLA Septin-2B OS=Xenopus laevis GN=sept2-b PE=2 SV=1 13 344 2.0E-108
sp|Q99719|SEPT5_HUMAN Septin-5 OS=Homo sapiens GN=SEPT5 PE=1 SV=1 14 385 2.0E-107
sp|Q5RA66|SEPT2_PONAB Septin-2 OS=Pongo abelii GN=SEPT2 PE=2 SV=1 13 303 3.0E-107
sp|Q15019|SEPT2_HUMAN Septin-2 OS=Homo sapiens GN=SEPT2 PE=1 SV=1 13 303 3.0E-107
sp|Q2NKY7|SEPT2_BOVIN Septin-2 OS=Bos taurus GN=SEPT2 PE=2 SV=1 13 303 5.0E-107
sp|P54359|SEPT2_DROME Septin-2 OS=Drosophila melanogaster GN=Sep2 PE=2 SV=2 10 402 7.0E-107
sp|Q91Y81|SEPT2_RAT Septin-2 OS=Rattus norvegicus GN=Sept2 PE=1 SV=1 13 303 7.0E-107
sp|P28661|SEPT4_MOUSE Septin-4 OS=Mus musculus GN=Sept4 PE=1 SV=1 14 306 8.0E-107
sp|Q0VC68|SEPT5_BOVIN Septin-5 OS=Bos taurus GN=SEPT5 PE=2 SV=1 14 306 1.0E-106
sp|Q9BGQ3|SEPT5_MACFA Septin-5 OS=Macaca fascicularis GN=Sept5 PE=2 SV=1 14 385 1.0E-106
sp|O43236|SEPT4_HUMAN Septin-4 OS=Homo sapiens GN=SEPT4 PE=1 SV=1 14 306 2.0E-106
sp|P42208|SEPT2_MOUSE Septin-2 OS=Mus musculus GN=Sept2 PE=1 SV=2 13 303 2.0E-106
sp|Q4R4X5|SEPT4_MACFA Septin-4 OS=Macaca fascicularis GN=SEPT4 PE=2 SV=1 14 306 3.0E-106
sp|Q5R6R7|SEPT4_PONAB Septin-4 OS=Pongo abelii GN=SEPT4 PE=2 SV=1 14 306 3.0E-106
sp|Q9Z2Q6|SEPT5_MOUSE Septin-5 OS=Mus musculus GN=Sept5 PE=1 SV=2 14 306 6.0E-106
sp|Q9JJM9|SEPT5_RAT Septin-5 OS=Rattus norvegicus GN=Sept5 PE=1 SV=2 14 306 7.0E-106
sp|Q6AXA6|SEP8A_XENLA Septin-8-A OS=Xenopus laevis GN=sept8-a PE=2 SV=1 11 390 2.0E-102
sp|Q6IRQ5|SEP8B_XENLA Septin-8-B OS=Xenopus laevis GN=sept8-b PE=2 SV=1 11 390 6.0E-102
sp|Q5PQK1|SEP10_RAT Septin-10 OS=Rattus norvegicus GN=Sept10 PE=1 SV=1 11 390 1.0E-101
sp|B1H120|SEPT8_XENTR Septin-8 OS=Xenopus tropicalis GN=sept8 PE=2 SV=1 11 390 1.0E-101
sp|Q8C650|SEP10_MOUSE Septin-10 OS=Mus musculus GN=Sept10 PE=1 SV=1 11 390 4.0E-101
sp|A5PJU9|SEPT1_BOVIN Septin-1 OS=Bos taurus GN=SEPT1 PE=2 SV=1 14 383 7.0E-101
sp|Q6ZU15|SEP14_HUMAN Septin-14 OS=Homo sapiens GN=SEPT14 PE=1 SV=2 5 387 2.0E-100
sp|Q9P0V9|SEP10_HUMAN Septin-10 OS=Homo sapiens GN=SEPT10 PE=1 SV=2 5 380 6.0E-100
sp|Q8WYJ6|SEPT1_HUMAN Septin-1 OS=Homo sapiens GN=SEPT1 PE=1 SV=2 14 377 7.0E-100
sp|Q642H3|SEP8A_DANRE Septin-8-A OS=Danio rerio GN=sept8a PE=2 SV=2 11 380 3.0E-99
sp|Q2KJB1|SEP10_BOVIN Septin-10 OS=Bos taurus GN=SEPT10 PE=2 SV=1 11 372 7.0E-99
sp|P42209|SEPT1_MOUSE Septin-1 OS=Mus musculus GN=Sept1 PE=1 SV=2 14 377 9.0E-99
sp|Q5EB96|SEPT1_RAT Septin-1 OS=Rattus norvegicus GN=Sept1 PE=1 SV=1 14 377 2.0E-98
sp|A4FUM1|SEP8B_DANRE Septin-8-B OS=Danio rerio GN=sept8b PE=2 SV=1 11 385 4.0E-98
sp|Q5REG8|SEP10_PONAB Septin-10 OS=Pongo abelii GN=SEPT10 PE=2 SV=1 5 380 6.0E-98
sp|Q5R8U3|SEP11_PONAB Septin-11 OS=Pongo abelii GN=SEPT11 PE=2 SV=3 11 350 2.0E-96
sp|Q9NVA2|SEP11_HUMAN Septin-11 OS=Homo sapiens GN=SEPT11 PE=1 SV=3 11 350 2.0E-96
sp|A2VE99|SEP11_BOVIN Septin-11 OS=Bos taurus GN=SEPT11 PE=2 SV=1 11 350 2.0E-96
sp|B1MTN8|SEPT8_CALMO Septin-8 OS=Callicebus moloch GN=SEPT8 PE=3 SV=1 11 350 3.0E-96
sp|Q8C1B7|SEP11_MOUSE Septin-11 OS=Mus musculus GN=Sept11 PE=1 SV=4 11 350 4.0E-96
sp|B3GNI6|SEP11_RAT Septin-11 OS=Rattus norvegicus GN=Sept11 PE=1 SV=1 11 350 4.0E-96
sp|B2KIE9|SEPT8_RHIFE Septin-8 OS=Rhinolophus ferrumequinum GN=SEPT8 PE=3 SV=1 11 350 1.0E-95
sp|Q14141|SEPT6_HUMAN Septin-6 OS=Homo sapiens GN=SEPT6 PE=1 SV=4 11 350 2.0E-95
sp|B0KWP7|SEPT8_CALJA Septin-8 OS=Callithrix jacchus GN=SEPT8 PE=3 SV=1 11 350 3.0E-95
sp|Q4R555|SEP11_MACFA Septin-11 OS=Macaca fascicularis GN=SEPT11 PE=2 SV=3 11 350 3.0E-95
sp|B5FW69|SEPT8_OTOGA Septin-8 OS=Otolemur garnettii GN=SEPT8 PE=3 SV=1 11 350 4.0E-95
sp|Q0VCP4|SEPT8_BOVIN Septin-8 OS=Bos taurus GN=SEPT8 PE=2 SV=3 11 350 6.0E-95
sp|Q8CHH9|SEPT8_MOUSE Septin-8 OS=Mus musculus GN=Sept8 PE=1 SV=4 11 350 1.0E-94
sp|Q92599|SEPT8_HUMAN Septin-8 OS=Homo sapiens GN=SEPT8 PE=1 SV=4 11 350 2.0E-94
sp|Q3SZN0|SEPT6_BOVIN Septin-6 OS=Bos taurus GN=SEPT6 PE=2 SV=1 11 350 2.0E-94
sp|Q9R1T4|SEPT6_MOUSE Septin-6 OS=Mus musculus GN=Sept6 PE=1 SV=4 11 350 6.0E-94
sp|A6QQL3|SEP14_BOVIN Septin-14 OS=Bos taurus GN=SEPT14 PE=2 SV=1 5 373 1.0E-93
sp|B0BNF1|SEPT8_RAT Septin-8 OS=Rattus norvegicus GN=Sept8 PE=1 SV=1 11 350 2.0E-93
sp|Q9QZR6|SEPT9_RAT Septin-9 OS=Rattus norvegicus GN=Sept9 PE=1 SV=1 13 312 1.0E-91
sp|Q08DM7|SEPT3_BOVIN Neuronal-specific septin-3 OS=Bos taurus GN=SEPT3 PE=2 SV=3 11 303 3.0E-91
sp|Q80UG5|SEPT9_MOUSE Septin-9 OS=Mus musculus GN=Sept9 PE=1 SV=1 13 312 5.0E-91
sp|A2BGU8|SEPT3_DANRE Neuronal-specific septin-3 OS=Danio rerio GN=sept3 PE=2 SV=1 11 303 5.0E-91
sp|P48009|SPN4_SCHPO Septin homolog spn4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn4 PE=1 SV=1 12 401 1.0E-90
sp|Q9UHD8|SEPT9_HUMAN Septin-9 OS=Homo sapiens GN=SEPT9 PE=1 SV=2 13 303 3.0E-90
sp|Q9Z1S5|SEPT3_MOUSE Neuronal-specific septin-3 OS=Mus musculus GN=Sept3 PE=1 SV=2 7 303 4.0E-90
sp|Q9UH03|SEPT3_HUMAN Neuronal-specific septin-3 OS=Homo sapiens GN=SEPT3 PE=1 SV=3 7 303 7.0E-90
sp|Q9DA97|SEP14_MOUSE Septin-14 OS=Mus musculus GN=Sept14 PE=1 SV=3 5 372 2.0E-89
sp|Q4V8G5|SEP12_RAT Septin-12 OS=Rattus norvegicus GN=Sept12 PE=1 SV=2 10 303 8.0E-89
sp|Q9WU34|SEPT3_RAT Neuronal-specific septin-3 OS=Rattus norvegicus GN=Sept3 PE=1 SV=2 7 303 1.0E-88
sp|A5D7Q3|SEP12_BOVIN Septin-12 OS=Bos taurus GN=SEPT12 PE=2 SV=1 13 303 2.0E-86
sp|Q8IYM1|SEP12_HUMAN Septin-12 OS=Homo sapiens GN=SEPT12 PE=1 SV=1 10 303 4.0E-84
sp|Q09116|SPN2_SCHPO Septin homolog spn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn2 PE=1 SV=2 11 331 8.0E-80
sp|P32468|CDC12_YEAST Cell division control protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC12 PE=1 SV=1 16 381 3.0E-77
sp|P48010|SPN5_SCHPO Septin homolog spn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn5 PE=1 SV=2 15 389 6.0E-76
sp|P39827|CDC10_CANAL Cell division control protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC10 PE=2 SV=1 14 306 5.0E-72
sp|P48008|SPN3_SCHPO Septin homolog spn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn3 PE=1 SV=3 26 366 1.0E-71
sp|P25342|CDC10_YEAST Cell division control protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC10 PE=1 SV=1 13 306 1.0E-71
sp|Q09883|SPN6_SCHPO Septin homolog spn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn6 PE=1 SV=1 30 376 1.0E-70
sp|P32458|CDC11_YEAST Cell division control protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC11 PE=1 SV=1 26 309 4.0E-61
sp|P41901|SPR3_YEAST Sporulation-regulated protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPR3 PE=1 SV=1 15 303 9.0E-59
sp|G1UB61|CDC11_CANAL Septin CDC11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC11 PE=1 SV=1 26 366 1.0E-50
sp|O60165|SPN7_SCHPO Septin homolog spn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn7 PE=1 SV=2 30 331 1.0E-46
sp|Q59VX8|SHS1_CANAL Septation protein 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEP7 PE=1 SV=1 25 303 2.0E-46
sp|Q8STS8|CDC11_ENCCU Cell division control protein 11 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC11 PE=1 SV=2 30 303 2.0E-45
sp|Q07657|SHS1_YEAST Seventh homolog of septin 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHS1 PE=1 SV=1 26 311 6.0E-45
sp|Q8SQR3|CDC10_ENCCU Cell division control protein 10 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC10 PE=1 SV=2 3 366 2.0E-42
sp|Q8SSI8|CDC3_ENCCU Cell division control protein 3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC3 PE=1 SV=1 15 352 4.0E-39
sp|Q04921|SPR28_YEAST Sporulation-regulated protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPR28 PE=1 SV=1 26 303 1.0E-37
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2598
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5306 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4237
Ophiocordyceps camponoti-floridani Ophcf2|04204
Ophiocordyceps camponoti-rufipedis Ophun1|2445
Ophiocordyceps kimflemingae Ophio5|8005
Ophiocordyceps subramaniannii Hirsu2|3930

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5306
MDTRNIVRRKLTGYVGFANLPNQWHRKSVRKGFNFNVMVVGESGLGKSTLVNTLFNTSLYPPKERKGPSLDIIPK
TVTIQSISADIEEAGVRLRLTVVDTPGFGDFVNNDESWRPIVDNIEQRYDAYLDAENKVNRMNIVDNRIHACVFF
IQPTGHSLKPLDIEVMRRLHTKVNLIPVIAKSDTLTDEEITNFKARVLSDIKYHNILIFEGPKYELDDDETIAEN
NEIMSKVPFAVVGATNEIKTADGRQVRGREYPWGIIEVDNEDHCDFVKLRQMLIRTHMEELKEHTNNLLYENYRT
EKLIAMGVSQDPSVFKEVNPAVKQEEERALHEQKLAKMEAEMKMVFQQKVAEKESKLKQSEEELYARHREMKEQL
ERQRVELEDKKQRIESGRPLEKEGKRKGFSLR*
Coding >OphauG2|5306
ATGGACACTCGAAACATTGTTCGACGGAAACTAACTGGATATGTCGGTTTTGCCAATCTTCCCAATCAATGGCAT
CGCAAGAGCGTCCGCAAAGGCTTCAATTTCAATGTCATGGTTGTCGGTGAATCTGGTCTGGGAAAGTCAACTTTG
GTCAATACGCTTTTCAATACGTCGTTGTATCCCCCCAAGGAGCGCAAGGGCCCAAGCCTCGACATTATTCCCAAG
ACGGTGACTATTCAGTCAATCAGCGCCGATATTGAGGAGGCTGGTGTACGTCTTCGCTTGACTGTCGTGGACACG
CCTGGCTTTGGAGACTTCGTCAACAACGATGAATCCTGGCGCCCCATTGTGGACAACATTGAGCAGCGCTACGAC
GCCTATCTAGATGCAGAGAACAAGGTCAACCGCATGAACATTGTAGACAACCGGATCCACGCCTGTGTCTTCTTT
ATCCAGCCCACTGGTCATTCGCTGAAGCCTCTCGACATTGAAGTCATGCGACGACTTCATACCAAGGTCAACCTT
ATTCCCGTCATTGCTAAGTCGGATACCCTTACGGACGAGGAGATCACAAACTTCAAGGCCAGGGTTTTGTCAGAT
ATCAAGTATCATAACATTCTGATCTTTGAGGGCCCCAAGTATGAGCTTGATGACGATGAGACCATTGCCGAAAAC
AATGAAATCATGTCCAAGGTGCCGTTTGCTGTGGTGGGTGCCACGAATGAAATCAAGACGGCAGATGGGCGCCAA
GTTCGCGGCCGTGAATACCCGTGGGGCATCATCGAGGTGGACAATGAGGATCACTGTGACTTTGTCAAGTTGCGT
CAGATGCTCATCAGGACTCACATGGAGGAACTCAAGGAGCATACCAACAATTTGCTCTATGAGAATTACCGCACC
GAGAAGCTCATTGCCATGGGCGTGTCGCAGGACCCTAGCGTCTTCAAGGAGGTCAATCCCGCTGTCAAGCAAGAG
GAGGAGCGCGCCTTGCACGAGCAAAAGCTTGCCAAGATGGAGGCTGAAATGAAGATGGTGTTCCAGCAAAAGGTT
GCAGAAAAGGAGAGCAAATTGAAGCAGTCTGAGGAGGAGCTTTACGCCCGACACAGAGAAATGAAGGAGCAGCTA
GAACGCCAGCGCGTTGAACTTGAGGACAAGAAGCAGCGCATCGAGAGCGGACGGCCTCTGGAGAAGGAAGGCAAG
CGGAAGGGTTTTTCATTGCGCTAA
Transcript >OphauG2|5306
ATGGACACTCGAAACATTGTTCGACGGAAACTAACTGGATATGTCGGTTTTGCCAATCTTCCCAATCAATGGCAT
CGCAAGAGCGTCCGCAAAGGCTTCAATTTCAATGTCATGGTTGTCGGTGAATCTGGTCTGGGAAAGTCAACTTTG
GTCAATACGCTTTTCAATACGTCGTTGTATCCCCCCAAGGAGCGCAAGGGCCCAAGCCTCGACATTATTCCCAAG
ACGGTGACTATTCAGTCAATCAGCGCCGATATTGAGGAGGCTGGTGTACGTCTTCGCTTGACTGTCGTGGACACG
CCTGGCTTTGGAGACTTCGTCAACAACGATGAATCCTGGCGCCCCATTGTGGACAACATTGAGCAGCGCTACGAC
GCCTATCTAGATGCAGAGAACAAGGTCAACCGCATGAACATTGTAGACAACCGGATCCACGCCTGTGTCTTCTTT
ATCCAGCCCACTGGTCATTCGCTGAAGCCTCTCGACATTGAAGTCATGCGACGACTTCATACCAAGGTCAACCTT
ATTCCCGTCATTGCTAAGTCGGATACCCTTACGGACGAGGAGATCACAAACTTCAAGGCCAGGGTTTTGTCAGAT
ATCAAGTATCATAACATTCTGATCTTTGAGGGCCCCAAGTATGAGCTTGATGACGATGAGACCATTGCCGAAAAC
AATGAAATCATGTCCAAGGTGCCGTTTGCTGTGGTGGGTGCCACGAATGAAATCAAGACGGCAGATGGGCGCCAA
GTTCGCGGCCGTGAATACCCGTGGGGCATCATCGAGGTGGACAATGAGGATCACTGTGACTTTGTCAAGTTGCGT
CAGATGCTCATCAGGACTCACATGGAGGAACTCAAGGAGCATACCAACAATTTGCTCTATGAGAATTACCGCACC
GAGAAGCTCATTGCCATGGGCGTGTCGCAGGACCCTAGCGTCTTCAAGGAGGTCAATCCCGCTGTCAAGCAAGAG
GAGGAGCGCGCCTTGCACGAGCAAAAGCTTGCCAAGATGGAGGCTGAAATGAAGATGGTGTTCCAGCAAAAGGTT
GCAGAAAAGGAGAGCAAATTGAAGCAGTCTGAGGAGGAGCTTTACGCCCGACACAGAGAAATGAAGGAGCAGCTA
GAACGCCAGCGCGTTGAACTTGAGGACAAGAAGCAGCGCATCGAGAGCGGACGGCCTCTGGAGAAGGAAGGCAAG
CGGAAGGGTTTTTCATTGCGCTAA
Gene >OphauG2|5306
ATGGACACTCGAAACATTGTTCGACGGAAACTAACTGGATATGTCGGTTTTGCCAATCTTCCCAATCAATGGCAT
CGCAAGAGCGTCCGCAAAGGCTTCAATTTCAATGTCATGGTTGTCGGTACGTGCATATAGCCCGCCAAGGAGCCA
TTTTTTGCAGCTCTAATGCGTGTCGTAGGTGAATCTGGTCTGGGAAAGTCAACTTTGGTCAATACGCTTTTCAAT
ACGTCGTTGTATCCCCCCAAGGAGCGCAAGGGCCCAAGCCTCGACATTATTCCCAAGACGGTGACTATTCAGTCA
ATCAGCGCCGATATTGAGGAGGCTGGTGTACGTCTTCGCTTGACTGTCGTGGACACGCCTGGCTTTGGAGACTTC
GTCAACAACGATGAATCCTGGCGCCCCATTGTGGACAACATTGAGCAGCGCTACGACGCCTATCTAGATGCAGAG
AACAAGGTCAACCGCATGAACATTGTAGACAACCGGATCCACGCCTGTGTCTTCTTTATCCAGCCCACTGGTCAT
TCGCTGAAGCCTCTCGACATTGAAGTCATGCGACGACTTCATACCAAGGTCAACCTTATTCCCGTCATTGCTAAG
TCGGATACCCTTACGGACGAGGAGATCACAAACTTCAAGGCCAGGGTTAGTTCACATAGGCGCCACCGTCTCTGA
CGACTAGACGTGCTGACTGAGTTGCCAGGTTTTGTCAGATATCAAGTATCATAACATTCTGATCTTTGAGGGCCC
CAAGTATGAGCTTGATGACGATGAGACCATTGCCGAAAACAATGAAATCATGTCCAAGGTGCCGTTTGCTGTGGT
GGGTGCCACGAATGAAATCAAGACGGCAGATGGGCGCCAAGTTCGCGGCCGTGAATACCCGTGGGGCATCATCGA
GGTGGACAATGAGGATCACTGTGACTTTGTCAAGTTGCGTCAGATGCTCATCAGGACTCACATGGAGGAACTCAA
GGAGCATACCAACAATTTGCTCTATGAGAATTACCGCACCGAGAAGCTCATTGCCATGGGCGTGTCGCAGGACCC
TAGCGTCTTCAAGGAGGTCAATCCCGCTGTCAAGCAAGAGGAGGAGCGCGCCTTGCACGAGCAAAAGCTTGCCAA
GATGGAGGCTGAAATGAAGATGGTGTTCCAGCAAAAGGTTGCAGAAAAGGAGAGCAAATTGAAGCAGTCTGAGGA
GGAGCTTTACGCCCGACACAGAGAAATGAAGGAGCAGCTAGAACGCCAGCGCGTTGAACTTGAGGACAAGAAGCA
GCGCATCGAGAGCGGACGGCCTCTGGAGAAGGAAGGCAAGCGGAAGGGTTTTTCATTGCGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail