Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5303
Gene name
LocationContig_481:3864..7428
Strand-
Gene length (bp)3564
Transcript length (bp)3411
Coding sequence length (bp)3411
Protein length (aa) 1137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02891 zf-MIZ MIZ/SP-RING zinc finger 8.6E-12 984 1040

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NF64|ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens GN=ZMIZ2 PE=1 SV=2 871 1095 2.0E-15
sp|Q8CIE2|ZMIZ2_MOUSE Zinc finger MIZ domain-containing protein 2 OS=Mus musculus GN=Zmiz2 PE=2 SV=2 871 1095 2.0E-15
sp|Q94361|GEI17_CAEEL E3 SUMO-protein ligase gei-17 OS=Caenorhabditis elegans GN=gei-17 PE=1 SV=4 944 1087 3.0E-14
sp|Q9ULJ6|ZMIZ1_HUMAN Zinc finger MIZ domain-containing protein 1 OS=Homo sapiens GN=ZMIZ1 PE=1 SV=3 871 1095 1.0E-13
sp|Q6P1E1|ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus GN=Zmiz1 PE=2 SV=1 871 1095 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NF64|ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens GN=ZMIZ2 PE=1 SV=2 871 1095 2.0E-15
sp|Q8CIE2|ZMIZ2_MOUSE Zinc finger MIZ domain-containing protein 2 OS=Mus musculus GN=Zmiz2 PE=2 SV=2 871 1095 2.0E-15
sp|Q94361|GEI17_CAEEL E3 SUMO-protein ligase gei-17 OS=Caenorhabditis elegans GN=gei-17 PE=1 SV=4 944 1087 3.0E-14
sp|Q9ULJ6|ZMIZ1_HUMAN Zinc finger MIZ domain-containing protein 1 OS=Homo sapiens GN=ZMIZ1 PE=1 SV=3 871 1095 1.0E-13
sp|Q6P1E1|ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus GN=Zmiz1 PE=2 SV=1 871 1095 1.0E-13
sp|Q04195|SIZ1_YEAST E3 SUMO-protein ligase SIZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIZ1 PE=1 SV=1 926 1086 9.0E-12
sp|Q12216|SIZ2_YEAST E3 SUMO-protein ligase SIZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFI1 PE=1 SV=1 962 1136 1.0E-09
sp|A0A0A7EPL0|PIAL1_ARATH E4 SUMO-protein ligase PIAL1 OS=Arabidopsis thaliana GN=PIAL1 PE=2 SV=1 959 1090 2.0E-09
sp|O94451|PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pli1 PE=1 SV=3 956 1135 5.0E-09
sp|O88907|PIAS1_MOUSE E3 SUMO-protein ligase PIAS1 OS=Mus musculus GN=Pias1 PE=1 SV=2 866 1081 2.0E-06
sp|O75928|PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens GN=PIAS2 PE=1 SV=3 962 1081 3.0E-06
sp|Q8C5D8|PIAS2_MOUSE E3 SUMO-protein ligase PIAS2 OS=Mus musculus GN=Pias2 PE=1 SV=2 962 1081 3.0E-06
sp|Q6AZ28|PIAS2_RAT E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus GN=Pias2 PE=1 SV=1 962 1081 3.0E-06
sp|O75925|PIAS1_HUMAN E3 SUMO-protein ligase PIAS1 OS=Homo sapiens GN=PIAS1 PE=1 SV=2 866 1081 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, MIZ-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup755
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5303 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3841
Ophiocordyceps camponoti-floridani Ophcf2|00931
Ophiocordyceps camponoti-floridani Ophcf2|00932
Ophiocordyceps camponoti-rufipedis Ophun1|4955
Ophiocordyceps kimflemingae Ophio5|5282
Ophiocordyceps subramaniannii Hirsu2|2359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5303
MAMSNETSYAFLGLQRPAWMLAATPCTTATAEKPNRARPGAPPRPSDATPSPPGSSQSQPQPHPPKWATNAPIKP
PGSHLSPRRPTVAMTAAADASRDTGADGPPGASTANFAPSQDTRIIAHAQHPLPPSQERQKMPAPHEPSILPSPA
LTSEPSPAASTPNFTESAAHAEGPAALSHHSLASPAASLNPTPLQSAQACHTSTQTPPTGPNEPSHDSSAHSVPQ
PEPGGTIHAVVTALAPSTAPPAAASPALILNPPRSASGAKRLSSQSAAPGPVQDEGAMDPRPQKRLRTVATPQTP
HTVSPVATDSPQPLVHYLQGFEAQLKAALPTAAGNSPIMMRYTLLLEAFQKNDTFFIILHQIFCLWLLDKNFAYP
LINVPRPLSDSALRILSSALNCNADLYMVNTTRWFASWPLPAKIYPGAQIRQMAAKVFQQIDHFIPAFVHKWQPV
AQETRNRGFPMLVGEMKEQLMCPSPTMHSIFFSSTRRAIGYTDDQPIALMLQRIFLLDQGNESQPRTDPVALSYL
RQGVVHQYSSLVMGSLTGQTQLSHTVSHHTHHTMSEHAPSAYYPGQPQIQLPVLMNNVAASTTVFSNSPHGVNAF
GANAGFRPMRGQGHIACPAPAYSTPMANSGNMLTPSLPDGFVASSPAGYVQGGAHAAAYSMPPQTATQSLQGQRL
IQTAPPPQVSDTRQSRLTRPMGNQQGAFFAQGQQQLVPLAQRPVQTWPSGPQQPPVARQSSQMGRGQHPVAQPSR
NLPPTNEWESVSVGLHLLHLRSPTRAPLGPSSHNDDKRFYQYVTHFAVEPRVMAARPGLRFASFSVSEEEKAKLV
MTTKSNGLPMALYSCKSLRYRLRMCKYDRDACEAKTGDWVTRPCAWPTCLFLTFNDQMIQPRRGQHFGRDLPIEL
SDLVCVGENTLKVSMPDEAANHVKDQLYWMAVEVVTFDDHDGVRLAVEMNEHTTIAETKQDVERRLTAGNSDDVV
VQNNSLCVSITDPFSFDMIETPVRGVDCKHLECFDLENWLQTRPQKQSKTGNEPCTVDCWKCPICGLDARPVSLR
VNDFLIDVRRNIKDNKSVCVKKIEIVADGSWKAIEEDDDDETEDETPLMNNLGPRRKEASSRTDSTPTVKRALRT
VIVLDDDDDDG*
Coding >OphauG2|5303
ATGGCCATGAGCAATGAAACGTCTTACGCCTTTCTCGGACTCCAGCGGCCGGCCTGGATGTTGGCGGCGACACCA
TGCACTACGGCCACGGCGGAAAAGCCAAACAGGGCAAGGCCTGGTGCTCCGCCGCGCCCATCAGATGCCACGCCG
AGCCCCCCCGGCTCCTCTCAATCTCAACCTCAACCTCATCCGCCCAAATGGGCAACAAATGCGCCAATCAAGCCC
CCCGGCTCCCATCTGTCGCCTCGTCGGCCGACTGTCGCCATGACTGCCGCTGCTGACGCTTCCCGCGACACGGGT
GCTGATGGGCCGCCTGGCGCCTCCACGGCCAATTTTGCGCCTTCACAAGACACTCGCATCATTGCCCACGCGCAA
CACCCTCTCCCGCCCTCGCAAGAGCGCCAGAAAATGCCTGCGCCGCATGAGCCCTCCATTCTTCCGTCGCCCGCT
CTCACCAGCGAGCCCAGCCCGGCTGCATCAACTCCCAATTTTACCGAGTCGGCTGCCCACGCTGAAGGCCCTGCC
GCTCTTTCACACCACAGTTTGGCCTCACCCGCTGCCAGCTTAAACCCGACGCCCTTGCAGTCTGCGCAAGCTTGC
CACACTTCGACTCAAACGCCGCCCACTGGCCCCAACGAACCGAGCCACGACTCTTCTGCCCATTCGGTCCCGCAG
CCCGAGCCTGGCGGCACCATACACGCTGTAGTCACGGCTTTGGCTCCCTCCACCGCCCCTCCGGCTGCTGCTTCC
CCCGCCCTCATTCTAAACCCGCCTCGCTCTGCCAGCGGTGCCAAGCGCCTCTCAAGCCAATCTGCTGCCCCTGGC
CCCGTCCAAGATGAGGGTGCAATGGATCCCAGGCCTCAGAAACGTCTGCGCACCGTTGCTACTCCTCAAACTCCA
CACACCGTCTCGCCTGTCGCGACAGACAGCCCCCAGCCTCTCGTTCACTACCTGCAGGGCTTTGAAGCCCAATTA
AAGGCCGCTTTACCCACTGCCGCAGGCAACTCTCCCATAATGATGCGATACACGCTGCTCCTCGAAGCCTTTCAG
AAAAACGACACCTTCTTCATCATACTCCATCAAATATTTTGCCTATGGCTGCTGGATAAAAACTTTGCTTACCCC
CTTATCAACGTTCCGCGCCCTCTGTCTGACTCTGCTCTCCGCATTCTCTCGAGTGCTCTGAATTGCAACGCGGAC
TTATACATGGTCAACACAACCCGCTGGTTCGCCTCGTGGCCACTTCCTGCCAAGATCTATCCTGGCGCCCAAATT
CGTCAAATGGCCGCCAAGGTTTTCCAGCAAATCGACCACTTTATCCCCGCCTTTGTTCACAAGTGGCAACCTGTT
GCACAAGAGACACGCAACAGAGGCTTTCCCATGCTGGTGGGGGAGATGAAGGAGCAGCTCATGTGTCCCTCGCCA
ACAATGCACTCCATCTTTTTCTCGTCGACAAGACGCGCAATTGGCTACACAGATGACCAGCCCATTGCCCTGATG
CTGCAACGCATCTTCCTCCTTGACCAAGGAAACGAGTCTCAGCCCCGTACTGACCCTGTGGCCTTGAGTTACTTG
CGCCAGGGCGTTGTGCATCAATACAGCTCTCTTGTCATGGGCTCTCTCACCGGCCAGACACAGCTGTCCCACACT
GTCTCTCATCACACCCACCACACGATGAGTGAGCACGCCCCAAGTGCTTACTATCCGGGCCAACCTCAAATCCAG
CTCCCCGTCTTGATGAACAATGTAGCTGCCTCTACGACAGTCTTTTCCAATAGTCCTCATGGCGTCAACGCCTTT
GGAGCAAATGCCGGATTTCGGCCCATGAGAGGCCAGGGTCACATCGCCTGTCCAGCTCCAGCTTACAGCACCCCA
ATGGCCAATAGCGGCAACATGTTGACTCCTTCGCTGCCAGACGGGTTTGTAGCCAGCAGTCCGGCTGGTTATGTG
CAAGGAGGTGCACATGCTGCGGCTTACTCGATGCCACCACAGACTGCAACTCAATCACTTCAAGGCCAAAGGTTG
ATACAAACAGCACCTCCGCCTCAAGTGTCAGACACGCGGCAAAGCCGACTCACGAGGCCCATGGGTAATCAGCAG
GGCGCTTTCTTTGCCCAGGGGCAGCAGCAGCTCGTTCCCCTCGCCCAGCGGCCCGTGCAAACGTGGCCATCAGGC
CCCCAACAGCCACCAGTGGCCAGGCAGTCAAGCCAAATGGGACGCGGTCAGCATCCTGTGGCTCAGCCAAGTCGC
AATCTGCCGCCCACAAATGAGTGGGAGTCTGTTTCTGTGGGCCTGCATCTGCTGCATTTGCGCAGTCCCACGAGA
GCACCCTTGGGGCCAAGTAGCCACAACGACGATAAACGCTTCTACCAATACGTGACGCATTTTGCAGTGGAGCCG
CGAGTCATGGCCGCCCGACCTGGTCTTCGCTTTGCTTCGTTTTCCGTGTCGGAGGAGGAAAAGGCCAAGCTCGTA
ATGACGACAAAGTCAAACGGCTTACCAATGGCCCTTTACAGTTGCAAATCGCTCCGCTACCGCCTTCGCATGTGT
AAATACGACCGAGACGCTTGCGAGGCAAAGACTGGCGATTGGGTGACTCGGCCATGTGCTTGGCCGACGTGTCTG
TTCTTGACATTTAATGACCAAATGATACAGCCACGTCGTGGTCAGCACTTTGGGCGAGACCTGCCAATCGAGCTC
TCGGACCTGGTGTGTGTTGGAGAGAATACGCTCAAGGTCAGCATGCCCGACGAGGCGGCCAATCATGTCAAGGAC
CAGCTCTACTGGATGGCGGTTGAAGTCGTCACGTTTGACGACCACGACGGCGTTCGTCTTGCGGTCGAGATGAAT
GAGCATACCACGATTGCTGAGACGAAGCAAGATGTTGAGCGGCGTCTGACAGCAGGCAATAGTGACGACGTCGTT
GTCCAAAACAACAGTCTCTGTGTCTCGATAACGGATCCCTTTAGCTTTGACATGATTGAAACACCTGTTCGCGGC
GTTGACTGCAAGCATCTTGAATGCTTTGATCTAGAAAACTGGTTGCAGACTCGACCGCAAAAGCAAAGCAAGACG
GGAAACGAGCCGTGTACAGTCGACTGCTGGAAGTGCCCCATATGTGGACTCGACGCCAGGCCTGTCAGTCTGCGA
GTCAATGACTTTCTCATTGACGTGCGCAGAAACATCAAGGACAACAAGAGCGTTTGTGTCAAGAAGATTGAGATT
GTTGCTGATGGTAGCTGGAAAGCGATTGAGGAGGACGACGACGACGAGACAGAAGACGAGACACCATTGATGAAT
AATTTGGGGCCGCGGCGAAAGGAGGCTTCGTCTAGGACAGATAGTACACCGACAGTGAAGCGCGCTCTTCGCACA
GTCATCGTTTTGGATGATGATGATGATGATGGTTAG
Transcript >OphauG2|5303
ATGGCCATGAGCAATGAAACGTCTTACGCCTTTCTCGGACTCCAGCGGCCGGCCTGGATGTTGGCGGCGACACCA
TGCACTACGGCCACGGCGGAAAAGCCAAACAGGGCAAGGCCTGGTGCTCCGCCGCGCCCATCAGATGCCACGCCG
AGCCCCCCCGGCTCCTCTCAATCTCAACCTCAACCTCATCCGCCCAAATGGGCAACAAATGCGCCAATCAAGCCC
CCCGGCTCCCATCTGTCGCCTCGTCGGCCGACTGTCGCCATGACTGCCGCTGCTGACGCTTCCCGCGACACGGGT
GCTGATGGGCCGCCTGGCGCCTCCACGGCCAATTTTGCGCCTTCACAAGACACTCGCATCATTGCCCACGCGCAA
CACCCTCTCCCGCCCTCGCAAGAGCGCCAGAAAATGCCTGCGCCGCATGAGCCCTCCATTCTTCCGTCGCCCGCT
CTCACCAGCGAGCCCAGCCCGGCTGCATCAACTCCCAATTTTACCGAGTCGGCTGCCCACGCTGAAGGCCCTGCC
GCTCTTTCACACCACAGTTTGGCCTCACCCGCTGCCAGCTTAAACCCGACGCCCTTGCAGTCTGCGCAAGCTTGC
CACACTTCGACTCAAACGCCGCCCACTGGCCCCAACGAACCGAGCCACGACTCTTCTGCCCATTCGGTCCCGCAG
CCCGAGCCTGGCGGCACCATACACGCTGTAGTCACGGCTTTGGCTCCCTCCACCGCCCCTCCGGCTGCTGCTTCC
CCCGCCCTCATTCTAAACCCGCCTCGCTCTGCCAGCGGTGCCAAGCGCCTCTCAAGCCAATCTGCTGCCCCTGGC
CCCGTCCAAGATGAGGGTGCAATGGATCCCAGGCCTCAGAAACGTCTGCGCACCGTTGCTACTCCTCAAACTCCA
CACACCGTCTCGCCTGTCGCGACAGACAGCCCCCAGCCTCTCGTTCACTACCTGCAGGGCTTTGAAGCCCAATTA
AAGGCCGCTTTACCCACTGCCGCAGGCAACTCTCCCATAATGATGCGATACACGCTGCTCCTCGAAGCCTTTCAG
AAAAACGACACCTTCTTCATCATACTCCATCAAATATTTTGCCTATGGCTGCTGGATAAAAACTTTGCTTACCCC
CTTATCAACGTTCCGCGCCCTCTGTCTGACTCTGCTCTCCGCATTCTCTCGAGTGCTCTGAATTGCAACGCGGAC
TTATACATGGTCAACACAACCCGCTGGTTCGCCTCGTGGCCACTTCCTGCCAAGATCTATCCTGGCGCCCAAATT
CGTCAAATGGCCGCCAAGGTTTTCCAGCAAATCGACCACTTTATCCCCGCCTTTGTTCACAAGTGGCAACCTGTT
GCACAAGAGACACGCAACAGAGGCTTTCCCATGCTGGTGGGGGAGATGAAGGAGCAGCTCATGTGTCCCTCGCCA
ACAATGCACTCCATCTTTTTCTCGTCGACAAGACGCGCAATTGGCTACACAGATGACCAGCCCATTGCCCTGATG
CTGCAACGCATCTTCCTCCTTGACCAAGGAAACGAGTCTCAGCCCCGTACTGACCCTGTGGCCTTGAGTTACTTG
CGCCAGGGCGTTGTGCATCAATACAGCTCTCTTGTCATGGGCTCTCTCACCGGCCAGACACAGCTGTCCCACACT
GTCTCTCATCACACCCACCACACGATGAGTGAGCACGCCCCAAGTGCTTACTATCCGGGCCAACCTCAAATCCAG
CTCCCCGTCTTGATGAACAATGTAGCTGCCTCTACGACAGTCTTTTCCAATAGTCCTCATGGCGTCAACGCCTTT
GGAGCAAATGCCGGATTTCGGCCCATGAGAGGCCAGGGTCACATCGCCTGTCCAGCTCCAGCTTACAGCACCCCA
ATGGCCAATAGCGGCAACATGTTGACTCCTTCGCTGCCAGACGGGTTTGTAGCCAGCAGTCCGGCTGGTTATGTG
CAAGGAGGTGCACATGCTGCGGCTTACTCGATGCCACCACAGACTGCAACTCAATCACTTCAAGGCCAAAGGTTG
ATACAAACAGCACCTCCGCCTCAAGTGTCAGACACGCGGCAAAGCCGACTCACGAGGCCCATGGGTAATCAGCAG
GGCGCTTTCTTTGCCCAGGGGCAGCAGCAGCTCGTTCCCCTCGCCCAGCGGCCCGTGCAAACGTGGCCATCAGGC
CCCCAACAGCCACCAGTGGCCAGGCAGTCAAGCCAAATGGGACGCGGTCAGCATCCTGTGGCTCAGCCAAGTCGC
AATCTGCCGCCCACAAATGAGTGGGAGTCTGTTTCTGTGGGCCTGCATCTGCTGCATTTGCGCAGTCCCACGAGA
GCACCCTTGGGGCCAAGTAGCCACAACGACGATAAACGCTTCTACCAATACGTGACGCATTTTGCAGTGGAGCCG
CGAGTCATGGCCGCCCGACCTGGTCTTCGCTTTGCTTCGTTTTCCGTGTCGGAGGAGGAAAAGGCCAAGCTCGTA
ATGACGACAAAGTCAAACGGCTTACCAATGGCCCTTTACAGTTGCAAATCGCTCCGCTACCGCCTTCGCATGTGT
AAATACGACCGAGACGCTTGCGAGGCAAAGACTGGCGATTGGGTGACTCGGCCATGTGCTTGGCCGACGTGTCTG
TTCTTGACATTTAATGACCAAATGATACAGCCACGTCGTGGTCAGCACTTTGGGCGAGACCTGCCAATCGAGCTC
TCGGACCTGGTGTGTGTTGGAGAGAATACGCTCAAGGTCAGCATGCCCGACGAGGCGGCCAATCATGTCAAGGAC
CAGCTCTACTGGATGGCGGTTGAAGTCGTCACGTTTGACGACCACGACGGCGTTCGTCTTGCGGTCGAGATGAAT
GAGCATACCACGATTGCTGAGACGAAGCAAGATGTTGAGCGGCGTCTGACAGCAGGCAATAGTGACGACGTCGTT
GTCCAAAACAACAGTCTCTGTGTCTCGATAACGGATCCCTTTAGCTTTGACATGATTGAAACACCTGTTCGCGGC
GTTGACTGCAAGCATCTTGAATGCTTTGATCTAGAAAACTGGTTGCAGACTCGACCGCAAAAGCAAAGCAAGACG
GGAAACGAGCCGTGTACAGTCGACTGCTGGAAGTGCCCCATATGTGGACTCGACGCCAGGCCTGTCAGTCTGCGA
GTCAATGACTTTCTCATTGACGTGCGCAGAAACATCAAGGACAACAAGAGCGTTTGTGTCAAGAAGATTGAGATT
GTTGCTGATGGTAGCTGGAAAGCGATTGAGGAGGACGACGACGACGAGACAGAAGACGAGACACCATTGATGAAT
AATTTGGGGCCGCGGCGAAAGGAGGCTTCGTCTAGGACAGATAGTACACCGACAGTGAAGCGCGCTCTTCGCACA
GTCATCGTTTTGGATGATGATGATGATGATGGTTAG
Gene >OphauG2|5303
ATGGCCATGAGCAATGAAACGTCTTACGCCTTTCTCGGACTCCAGCGGCCGGCCTGGATGTTGGCGGCGACACCA
TGCACTACGGCCACGGCGGAAAAGCCAAACAGGGCAAGGCCTGGTGCTCCGCCGCGCCCATCAGATGCCACGCCG
AGCCCCCCCGGCTCCTCTCAATCTCAACCTCAACCTCATCCGCCCAAATGGGCAACAAATGCGCCAATCAAGCCC
CCCGGCTCCCATCTGTCGCCTCGTCGGCCGACTGTCGCCATGACTGCCGCTGCTGACGCTTCCCGCGACACGGGT
GCTGATGGGCCGCCTGGCGCCTCCACGGCCAATTTTGCGCCTTCACAAGACACTCGCATCATTGCCCACGCGCAA
CACCCTCTCCCGCCCTCGCAAGAGCGCCAGAAAATGCCTGCGCCGCAGTGAGCTTCTCATTTTGCCCTCGCCCAA
ATCTCTAGACTCCCACACTGACTCTCTTGCTGCCCGCCCTCTCTGACTCGCAGTGAGCCCTCCATTCTTCCGTCG
CCCGCTCTCACCAGCGAGCCCAGCCCGGCTGCATCAACTCCCAATTTTACCGAGTCGGCTGCCCACGCTGAAGGC
CCTGCCGCTCTTTCACACCACAGTTTGGCCTCACCCGCTGCCAGCTTAAACCCGACGCCCTTGCAGTCTGCGCAA
GCTTGCCACACTTCGACTCAAACGCCGCCCACTGGCCCCAACGAACCGAGCCACGACTCTTCTGCCCATTCGGTC
CCGCAGCCCGAGCCTGGCGGCACCATACACGCTGTAGTCACGGCTTTGGCTCCCTCCACCGCCCCTCCGGCTGCT
GCTTCCCCCGCCCTCATTCTAAACCCGCCTCGCTCTGCCAGCGGTGCCAAGCGCCTCTCAAGCCAATCTGCTGCC
CCTGGCCCCGTCCAAGATGAGGGTGCAATGGATCCCAGGCCTCAGAAACGTCTGCGCACCGTTGCTACTCCTCAA
ACTCCACACACCGTCTCGCCTGTCGCGACAGACAGCCCCCAGCCTCTCGTTCACTACCTGCAGGGCTTTGAAGCC
CAATTAAAGGCCGCTTTACCCACTGCCGCAGGCAACTCTCCCATAATGATGCGATACACGCTGCTCCTCGAAGCC
TTTCAGAAAAACGACACCTTCTTCATCATACTCCATCAAATATTTTGCCTATGGCTGCTGGATAAAAACTTTGCT
TACCCCCTTATCAACGTTCCGCGCCCTCTGTCTGACTCTGCTCTCCGCATTCTCTCGAGTGCTCTGAATTGCAAC
GCGGACTTATACATGGTCAACACAACCCGCTGGTTCGCCTCGTGGCCACTTCCTGCCAAGATCTATCCTGGCGCC
CAAATTCGTCAAATGGCCGCCAAGGTTTTCCAGCAAATCGACCACTTTATCCCCGCCTTTGTTCACAAGTGGCAA
CCTGTTGCACAAGAGACACGCAACAGAGGCTTTCCCATGCTGGTGGGGGAGATGAAGGAGCAGCTCATGTGTCCC
TCGCCAACAATGCACTCCATCTTTTTCTCGTCGACAAGACGCGCAATTGGCTACACAGATGACCAGCCCATTGCC
CTGATGCTGCAACGCATCTTCCTCCTTGACCAAGGAAACGAGTCTCAGCCCCGTACTGACCCTGTGGCCTTGAGT
TACTTGCGCCAGGGCGTTGTGCATCAATACAGCTCTCTTGTCATGGGTAGGCCATCATAACTTGTCCCTCAGCAT
TTTGCTTCAAGCTAGGCCCCCACATGCTGATGGTTTCATGCAGGCTCTCTCACCGGCCAGACACAGCTGTCCCAC
ACTGTCTCTCATCACACCCACCACACGATGAGTGAGCACGCCCCAAGTGCTTACTATCCGGGCCAACCTCAAATC
CAGCTCCCCGTCTTGATGAACAATGTAGCTGCCTCTACGACAGTCTTTTCCAATAGTCCTCATGGCGTCAACGCC
TTTGGAGCAAATGCCGGATTTCGGCCCATGAGAGGCCAGGGTCACATCGCCTGTCCAGCTCCAGCTTACAGCACC
CCAATGGCCAATAGCGGCAACATGTTGACTCCTTCGCTGCCAGACGGGTTTGTAGCCAGCAGTCCGGCTGGTTAT
GTGCAAGGAGGTGCACATGCTGCGGCTTACTCGATGCCACCACAGACTGCAACTCAATCACTTCAAGGCCAAAGG
TTGATACAAACAGCACCTCCGCCTCAAGTGTCAGACACGCGGCAAAGCCGACTCACGAGGCCCATGGGTAATCAG
CAGGGCGCTTTCTTTGCCCAGGGGCAGCAGCAGCTCGTTCCCCTCGCCCAGCGGCCCGTGCAAACGTGGCCATCA
GGCCCCCAACAGCCACCAGTGGCCAGGCAGTCAAGCCAAATGGGACGCGGTCAGCATCCTGTGGCTCAGCCAAGT
CGCAATCTGCCGCCCACAAATGAGTGGGAGTCTGTTTCTGTGGGCCTGCATCTGCTGCATTTGCGCAGTCCCACG
AGAGCACCCTTGGGGCCAAGTAGCCACAACGACGATAAACGCTTCTACCAATACGTGACGCATTTTGCAGTGGAG
CCGCGAGTCATGGCCGCCCGACCTGGTCTTCGCTTTGCTTCGTTTTCCGTGTCGGAGGAGGAAAAGGCCAAGCTC
GTAATGACGACAAAGTCAAACGGCTTACCAATGGCCCTTTACAGTTGCAAATCGCTCCGCTACCGCCTTCGCATG
TGTAAATACGACCGAGACGCTTGCGAGGCAAAGACTGGCGATTGGGTGACTCGGCCATGTGCTTGGCCGACGTGT
CTGTTCTTGACATTTAATGACCAAATGATACAGCCACGTCGTGGTCAGCACTTTGGGCGAGACCTGCCAATCGAG
CTCTCGGACCTGGTGTGTGTTGGAGAGAATACGCTCAAGGTCAGCATGCCCGACGAGGCGGCCAATCATGTCAAG
GACCAGCTCTACTGGATGGCGGTTGAAGTCGTCACGTTTGACGACCACGACGGCGTTCGTCTTGCGGTCGAGATG
AATGAGCATACCACGATTGCTGAGACGAAGCAAGATGTTGAGCGGCGTCTGACAGCAGGCAATAGTGACGACGTC
GTTGTCCAAAACAACAGTCTCTGTGTCTCGATAACGGATCCCTTTAGCTTTGACATGATTGAAACACCTGTTCGC
GGCGTTGACTGCAAGCATCTTGAATGCTTTGATCTAGAAAACTGGTTGCAGACTCGACCGCAAAAGCAAAGCAAG
ACGGGAAACGAGCCGTGTACAGTCGACTGCTGGAAGTGCCCCATATGTGGACTCGACGCCAGGCCTGTCAGTCTG
CGAGTCAATGACTTTCTCATTGACGTGCGCAGAAACATCAAGGACAACAAGAGCGTTTGTGTCAAGAAGATTGAG
ATTGTTGCTGATGGTAGCTGGAAAGCGATTGAGGAGGACGACGACGACGAGACAGAAGACGAGACACCATTGATG
AATAATTTGGGGCCGCGGCGAAAGGAGGCTTCGTCTAGGACAGATAGTACACCGACAGTGAAGCGCGCTCTTCGC
ACAGTCATCGTTTTGGATGATGATGATGATGATGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail