Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5294
Gene name
LocationContig_48:37304..37903
Strand-
Gene length (bp)599
Transcript length (bp)285
Coding sequence length (bp)285
Protein length (aa) 95

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01907 Ribosomal_L37e Ribosomal protein L37e 5.4E-28 2 54

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0T1|RL37_EMENI 60S ribosomal protein L37 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rpl37 PE=3 SV=1 1 88 3.0E-46
sp|O44125|RL37_SCHMA 60S ribosomal protein L37 OS=Schistosoma mansoni GN=RPL37 PE=3 SV=3 1 88 3.0E-42
sp|Q9VXX8|RL371_DROME Probable 60S ribosomal protein L37-A OS=Drosophila melanogaster GN=RpL37a PE=1 SV=1 1 86 3.0E-42
sp|Q962S7|RL37_SPOFR 60S ribosomal protein L37 OS=Spodoptera frugiperda GN=RpL37 PE=3 SV=3 1 90 2.0E-41
sp|P49166|RL37A_YEAST 60S ribosomal protein L37-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL37A PE=1 SV=2 1 86 7.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0T1|RL37_EMENI 60S ribosomal protein L37 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rpl37 PE=3 SV=1 1 88 3.0E-46
sp|O44125|RL37_SCHMA 60S ribosomal protein L37 OS=Schistosoma mansoni GN=RPL37 PE=3 SV=3 1 88 3.0E-42
sp|Q9VXX8|RL371_DROME Probable 60S ribosomal protein L37-A OS=Drosophila melanogaster GN=RpL37a PE=1 SV=1 1 86 3.0E-42
sp|Q962S7|RL37_SPOFR 60S ribosomal protein L37 OS=Spodoptera frugiperda GN=RpL37 PE=3 SV=3 1 90 2.0E-41
sp|P49166|RL37A_YEAST 60S ribosomal protein L37-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL37A PE=1 SV=2 1 86 7.0E-41
sp|P51402|RL37B_YEAST 60S ribosomal protein L37-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL37B PE=1 SV=2 1 84 7.0E-40
sp|P59289|RL37A_SCHPO 60S ribosomal protein L37-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl3703 PE=1 SV=2 1 86 1.0E-39
sp|P05733|RL37B_SCHPO 60S ribosomal protein L37-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl3702 PE=1 SV=4 1 83 6.0E-39
sp|Q43292|RL372_ARATH 60S ribosomal protein L37-2 OS=Arabidopsis thaliana GN=RPL37B PE=3 SV=2 1 85 2.0E-37
sp|Q6BPF6|RL37_DEBHA 60S ribosomal protein L37 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPL37 PE=3 SV=1 1 84 2.0E-37
sp|Q90YT1|RL37_ICTPU 60S ribosomal protein L37 OS=Ictalurus punctatus GN=rpl37 PE=3 SV=3 1 87 5.0E-37
sp|Q54MG6|RL37_DICDI 60S ribosomal protein L37 OS=Dictyostelium discoideum GN=rpl37 PE=3 SV=1 1 91 7.0E-37
sp|Q8LEM8|RL373_ARATH 60S ribosomal protein L37-3 OS=Arabidopsis thaliana GN=RPL37C PE=3 SV=1 1 94 7.0E-37
sp|Q9W1U6|RL372_DROME Probable 60S ribosomal protein L37-B OS=Drosophila melanogaster GN=RpL37b PE=3 SV=1 1 81 1.0E-36
sp|Q9P836|RL37_CANAX 60S ribosomal protein L37 (Fragment) OS=Candida albicans GN=RPL37 PE=2 SV=1 3 84 1.0E-36
sp|P61928|RL37_RAT 60S ribosomal protein L37 OS=Rattus norvegicus GN=Rpl37 PE=1 SV=2 1 87 2.0E-36
sp|Q9D823|RL37_MOUSE 60S ribosomal protein L37 OS=Mus musculus GN=Rpl37 PE=3 SV=3 1 87 2.0E-36
sp|P61927|RL37_HUMAN 60S ribosomal protein L37 OS=Homo sapiens GN=RPL37 PE=1 SV=2 1 87 2.0E-36
sp|P79244|RL37_BOVIN 60S ribosomal protein L37 OS=Bos taurus GN=RPL37 PE=3 SV=4 1 87 2.0E-36
sp|Q8LFH7|RL371_ARATH 60S ribosomal protein L37-1 OS=Arabidopsis thaliana GN=RPL37A PE=3 SV=1 1 94 2.0E-35
sp|P0DJ24|RL37_TETTS 60S ribosomal protein L37 OS=Tetrahymena thermophila (strain SB210) GN=RPL37 PE=1 SV=1 1 81 3.0E-29
sp|P49622|RL37_CAEEL 60S ribosomal protein L37 OS=Caenorhabditis elegans GN=rpl-37 PE=3 SV=2 1 84 1.0E-26
sp|P62885|RL37_LEIDO 60S ribosomal protein L37 OS=Leishmania donovani GN=RPL37 PE=3 SV=2 1 79 8.0E-22
sp|P62886|RL37_LEIIN 60S ribosomal protein L37 OS=Leishmania infantum GN=RPL37 PE=3 SV=2 1 79 8.0E-22
sp|P49212|RL37_SOLLC 60S ribosomal protein L37 (Fragment) OS=Solanum lycopersicum GN=RPL37 PE=2 SV=1 34 81 6.0E-18
sp|Q8SRH5|RL37_ENCCU 60S ribosomal protein L37 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL37 PE=3 SV=1 1 83 3.0E-13
sp|P54011|RL37_METJA 50S ribosomal protein L37e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl37e PE=3 SV=1 1 52 1.0E-12
sp|A3CS13|RL37_METMJ 50S ribosomal protein L37e OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl37e PE=3 SV=1 1 52 4.0E-11
sp|Q8TYS1|RL37_METKA 50S ribosomal protein L37e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl37e PE=3 SV=1 1 57 6.0E-11
sp|A7I4F7|RL37_METB6 50S ribosomal protein L37e OS=Methanoregula boonei (strain 6A8) GN=rpl37e PE=3 SV=1 1 52 1.0E-10
sp|Q465S2|RL37_METBF 50S ribosomal protein L37e OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl37e PE=3 SV=1 1 54 1.0E-10
sp|Q12U31|RL37_METBU 50S ribosomal protein L37e OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl37e PE=3 SV=1 1 54 1.0E-10
sp|Q8PZZ8|RL37_METMA 50S ribosomal protein L37e OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl37e PE=3 SV=1 1 54 1.0E-10
sp|A6VG90|RL37_METM7 50S ribosomal protein L37e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl37e PE=3 SV=1 1 62 2.0E-10
sp|A4FX24|RL37_METM5 50S ribosomal protein L37e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl37e PE=3 SV=1 1 62 2.0E-10
sp|Q8TL48|RL37_METAC 50S ribosomal protein L37e OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl37e PE=3 SV=1 1 54 2.0E-10
sp|P32410|RL37_HALMA 50S ribosomal protein L37e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl37e PE=1 SV=2 4 53 3.0E-10
sp|A9AAG2|RL37_METM6 50S ribosomal protein L37e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl37e PE=3 SV=1 1 62 3.0E-10
sp|Q6LY46|RL37_METMP 50S ribosomal protein L37e OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl37e PE=3 SV=1 1 62 3.0E-10
sp|A6UTQ8|RL37_META3 50S ribosomal protein L37e OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl37e PE=3 SV=1 1 52 4.0E-10
sp|O26744|RL37_METTH 50S ribosomal protein L37e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl37e PE=3 SV=1 2 52 6.0E-10
sp|B8GJW5|RL37_METPE 50S ribosomal protein L37e OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rpl37e PE=3 SV=1 1 52 6.0E-10
sp|A9A2Y8|RL37_NITMS 50S ribosomal protein L37e OS=Nitrosopumilus maritimus (strain SCM1) GN=rpl37e PE=3 SV=1 1 49 6.0E-10
sp|Q9HPS3|RL37_HALSA 50S ribosomal protein L37e OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl37e PE=3 SV=1 4 52 7.0E-10
sp|B0R5R1|RL37_HALS3 50S ribosomal protein L37e OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl37e PE=3 SV=1 4 52 7.0E-10
sp|A6UPF4|RL37_METVS 50S ribosomal protein L37e OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl37e PE=3 SV=1 1 62 8.0E-10
sp|Q18GA1|RL37_HALWD 50S ribosomal protein L37e OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl37e PE=3 SV=1 4 52 9.0E-10
sp|Q97BU6|RL37_THEVO 50S ribosomal protein L37e OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl37e PE=3 SV=1 1 51 9.0E-10
sp|Q9HIT7|RL37_THEAC 50S ribosomal protein L37e OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl37e PE=3 SV=1 1 51 2.0E-09
sp|Q2NF48|RL37_METST 50S ribosomal protein L37e OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl37e PE=3 SV=1 3 52 3.0E-09
sp|A0B5Q5|RL37_METTP 50S ribosomal protein L37e OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl37e PE=3 SV=1 1 53 3.0E-09
sp|Q2FT51|RL37_METHJ 50S ribosomal protein L37e OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl37e PE=3 SV=1 1 52 4.0E-09
sp|A0RZA3|RL37_CENSY 50S ribosomal protein L37e OS=Cenarchaeum symbiosum (strain A) GN=rpl37e PE=3 SV=1 1 51 4.0E-09
sp|Q3INQ6|RL37_NATPD 50S ribosomal protein L37e OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl37e PE=3 SV=1 4 52 6.0E-09
sp|A1RX99|RL37_THEPD 50S ribosomal protein L37e OS=Thermofilum pendens (strain Hrk 5) GN=rpl37e PE=3 SV=1 1 52 7.0E-09
sp|B8D688|RL37_DESK1 50S ribosomal protein L37e OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl37e PE=3 SV=1 1 52 7.0E-09
sp|A8AB57|RL37_IGNH4 50S ribosomal protein L37e OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl37e PE=3 SV=1 1 52 9.0E-09
sp|Q975S6|RL37_SULTO 50S ribosomal protein L37e OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl37e PE=3 SV=1 2 52 1.0E-08
sp|B6YUU6|RL37_THEON 50S ribosomal protein L37e OS=Thermococcus onnurineus (strain NA1) GN=rpl37e PE=3 SV=1 1 57 2.0E-08
sp|Q9YEQ4|RL37_AERPE 50S ribosomal protein L37e OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl37e PE=3 SV=1 1 52 2.0E-08
sp|B9LQK2|RL37_HALLT 50S ribosomal protein L37e OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl37e PE=3 SV=1 4 53 4.0E-08
sp|C5A1H2|RL37_THEGJ 50S ribosomal protein L37e OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl37e PE=3 SV=1 1 57 1.0E-07
sp|O29387|RL37_ARCFU 50S ribosomal protein L37e OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl37e PE=3 SV=1 1 56 1.0E-07
sp|Q8U0P5|RL37_PYRFU 50S ribosomal protein L37e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl37e PE=1 SV=1 1 50 2.0E-07
sp|P62005|RL37_PYRHO 50S ribosomal protein L37e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl37e PE=3 SV=1 1 50 2.0E-07
sp|P62004|RL37_PYRAB 50S ribosomal protein L37e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl37e PE=3 SV=1 1 50 2.0E-07
sp|A2BN31|RL37_HYPBU 50S ribosomal protein L37e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl37e PE=3 SV=1 1 52 3.0E-07
sp|A3DN33|RL37_STAMF 50S ribosomal protein L37e OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl37e PE=3 SV=1 1 52 3.0E-07
sp|Q5JIE1|RL37_THEKO 50S ribosomal protein L37e OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl37e PE=3 SV=1 1 57 3.0E-07
sp|Q4JAZ9|RL37_SULAC 50S ribosomal protein L37e OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl37e PE=3 SV=1 3 52 4.0E-07
sp|C3NEA7|RL37_SULIY 50S ribosomal protein L37e OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl37e PE=3 SV=1 3 52 8.0E-07
sp|C3MVE4|RL37_SULIM 50S ribosomal protein L37e OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl37e PE=3 SV=1 3 52 8.0E-07
sp|C3MQ25|RL37_SULIL 50S ribosomal protein L37e OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl37e PE=3 SV=1 3 52 8.0E-07
sp|C4KHB9|RL37_SULIK 50S ribosomal protein L37e OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl37e PE=3 SV=1 3 52 8.0E-07
sp|C3N5P3|RL37_SULIA 50S ribosomal protein L37e OS=Sulfolobus islandicus (strain M.16.27) GN=rpl37e PE=3 SV=1 3 52 8.0E-07
sp|Q97ZQ1|RL37_SULSO 50S ribosomal protein L37e OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl37e PE=3 SV=1 3 52 9.0E-07
sp|C3NHE2|RL37_SULIN 50S ribosomal protein L37e OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl37e PE=3 SV=1 3 52 1.0E-06
sp|A8MA81|RL37_CALMQ 50S ribosomal protein L37e OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl37e PE=3 SV=1 1 39 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3441
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5294 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5059
Ophiocordyceps camponoti-floridani Ophcf2|06158
Ophiocordyceps camponoti-rufipedis Ophun1|5114
Ophiocordyceps kimflemingae Ophio5|5333
Ophiocordyceps subramaniannii Hirsu2|6540

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5294
MTKGTSSFGKRHNKTHTLCRRCGRRSLHIQKKECSSCGYPAAKTRKYNWSEKAKRRKTTGTGRMRHLKDVSRRFH
NGFRNGQPKNARGTAKQES*
Coding >OphauG2|5294
ATGACCAAGGGTACCTCCAGCTTCGGTAAGCGTCACAACAAGACGCACACGCTATGCCGACGATGCGGCCGCCGC
TCGCTGCACATTCAGAAGAAAGAATGCTCATCCTGCGGCTATCCTGCTGCCAAGACTCGAAAATACAACTGGAGC
GAAAAGGCAAAACGGAGAAAGACGACTGGCACTGGCCGCATGCGCCACCTCAAGGACGTTTCGCGACGATTTCAC
AATGGCTTCCGCAATGGCCAGCCTAAGAATGCCCGAGGCACGGCCAAGCAGGAGTCTTGA
Transcript >OphauG2|5294
ATGACCAAGGGTACCTCCAGCTTCGGTAAGCGTCACAACAAGACGCACACGCTATGCCGACGATGCGGCCGCCGC
TCGCTGCACATTCAGAAGAAAGAATGCTCATCCTGCGGCTATCCTGCTGCCAAGACTCGAAAATACAACTGGAGC
GAAAAGGCAAAACGGAGAAAGACGACTGGCACTGGCCGCATGCGCCACCTCAAGGACGTTTCGCGACGATTTCAC
AATGGCTTCCGCAATGGCCAGCCTAAGAATGCCCGAGGCACGGCCAAGCAGGAGTCTTGA
Gene >OphauG2|5294
ATGAGTACGTTTTGAAATGCTGCTCTGCTGCAAATGCATCTGCTCATGCCATTCGATGCTAATAACCATTGCAGC
CAAGGGTACCTCCAGCTTCGGTAAGCGTCACAACAAGACGCACACGCTATGCCGACGATGCGGTTAGTTTTTCTC
TGCTCTGGCGACCTTGCGACGTAACCAGCGAGACGTTTATCGAATTGCTGGTGGCTTTGAGACGCTGGAAAAGCT
ACTCCTCTGGAATTGGAGCAGTAGGAGAACTAACAGCTTGTTGGGCAGGCCGCCGCTCGCTGCACATTCAGAAGA
AAGAATGCTCATCCTGCGGCTATCCTGCTGCCAAGACTCGAAAATGTACGAATTGGTCCTTGTCTGTGCTATCAC
TAGGAAACGAGAAGTATCAAGGACGAAAATTGAGAGCCATGAAGAAGACTAACGGGGGCCCCCTTGACCTATCTG
CAGACAACTGGAGCGAAAAGGCAAAACGGAGAAAGACGACTGGCACTGGCCGCATGCGCCACCTCAAGGACGTTT
CGCGACGATTTCACAATGGCTTCCGCAATGGCCAGCCTAAGAATGCCCGAGGCACGGCCAAGCAGGAGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail