Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5287
Gene name
LocationContig_48:21445..23032
Strand+
Gene length (bp)1587
Transcript length (bp)1425
Coding sequence length (bp)1425
Protein length (aa) 475

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03630 Fumble Fumble 1.3E-144 95 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74962|PANK_SCHPO Pantothenate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4B4.01c PE=1 SV=1 35 446 5.0E-107
sp|Q04430|PANK_YEAST Pantothenate kinase CAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB1 PE=1 SV=1 95 440 7.0E-101
sp|Q0J035|PANK2_ORYSJ Pantothenate kinase 2 OS=Oryza sativa subsp. japonica GN=Os09g0533100 PE=2 SV=2 84 440 1.0E-91
sp|Q8L5Y9|PANK2_ARATH Pantothenate kinase 2 OS=Arabidopsis thaliana GN=PANK2 PE=1 SV=2 64 440 6.0E-90
sp|O80765|PANK1_ARATH Pantothenate kinase 1 OS=Arabidopsis thaliana GN=PANK1 PE=2 SV=2 93 439 3.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74962|PANK_SCHPO Pantothenate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4B4.01c PE=1 SV=1 35 446 5.0E-107
sp|Q04430|PANK_YEAST Pantothenate kinase CAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB1 PE=1 SV=1 95 440 7.0E-101
sp|Q0J035|PANK2_ORYSJ Pantothenate kinase 2 OS=Oryza sativa subsp. japonica GN=Os09g0533100 PE=2 SV=2 84 440 1.0E-91
sp|Q8L5Y9|PANK2_ARATH Pantothenate kinase 2 OS=Arabidopsis thaliana GN=PANK2 PE=1 SV=2 64 440 6.0E-90
sp|O80765|PANK1_ARATH Pantothenate kinase 1 OS=Arabidopsis thaliana GN=PANK1 PE=2 SV=2 93 439 3.0E-86
sp|Q9NVE7|PANK4_HUMAN Pantothenate kinase 4 OS=Homo sapiens GN=PANK4 PE=1 SV=1 96 471 5.0E-80
sp|Q4R4U1|PANK4_MACFA Pantothenate kinase 4 OS=Macaca fascicularis GN=PANK4 PE=2 SV=2 96 471 6.0E-80
sp|Q5R5F8|PANK4_PONAB Pantothenate kinase 4 OS=Pongo abelii GN=PANK4 PE=2 SV=1 96 471 6.0E-78
sp|Q923S8|PANK4_RAT Pantothenate kinase 4 OS=Rattus norvegicus GN=Pank4 PE=1 SV=1 96 471 7.0E-73
sp|Q80YV4|PANK4_MOUSE Pantothenate kinase 4 OS=Mus musculus GN=Pank4 PE=1 SV=2 96 441 1.0E-72
sp|Q69TF4|PANK1_ORYSJ Pantothenate kinase 1 OS=Oryza sativa subsp. japonica GN=Os06g0207000 PE=2 SV=1 47 440 4.0E-72
sp|Q8K4K6|PANK1_MOUSE Pantothenate kinase 1 OS=Mus musculus GN=Pank1 PE=1 SV=1 96 440 5.0E-56
sp|Q8TE04|PANK1_HUMAN Pantothenate kinase 1 OS=Homo sapiens GN=PANK1 PE=1 SV=2 96 440 3.0E-54
sp|Q08DA5|PANK3_BOVIN Pantothenate kinase 3 OS=Bos taurus GN=PANK3 PE=2 SV=1 121 440 7.0E-50
sp|Q9H999|PANK3_HUMAN Pantothenate kinase 3 OS=Homo sapiens GN=PANK3 PE=1 SV=1 121 440 1.0E-49
sp|Q9BZ23|PANK2_HUMAN Pantothenate kinase 2, mitochondrial OS=Homo sapiens GN=PANK2 PE=1 SV=3 74 440 1.0E-49
sp|Q8R2W9|PANK3_MOUSE Pantothenate kinase 3 OS=Mus musculus GN=Pank3 PE=2 SV=1 121 440 5.0E-49
sp|Q69TF4|PANK1_ORYSJ Pantothenate kinase 1 OS=Oryza sativa subsp. japonica GN=Os06g0207000 PE=2 SV=1 199 445 1.0E-43
sp|B7JSQ5|COAW_BACC0 Type II pantothenate kinase OS=Bacillus cereus (strain AH820) GN=coaW PE=3 SV=1 94 440 3.0E-12
sp|Q6HHK0|COAW_BACHK Type II pantothenate kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=coaW PE=3 SV=1 94 441 7.0E-12
sp|Q63A51|COAW_BACCZ Type II pantothenate kinase OS=Bacillus cereus (strain ZK / E33L) GN=coaW PE=3 SV=1 94 440 6.0E-11
sp|Q736G1|COAW_BACC1 Type II pantothenate kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=coaW PE=3 SV=1 94 441 6.0E-09
sp|B7H5Z8|COAW_BACC4 Type II pantothenate kinase OS=Bacillus cereus (strain B4264) GN=coaW PE=3 SV=1 96 441 8.0E-09
sp|Q81C81|COAW_BACCR Type II pantothenate kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=coaW PE=3 SV=1 96 441 1.0E-08
sp|B7IKP3|COAW_BACC2 Type II pantothenate kinase OS=Bacillus cereus (strain G9842) GN=coaW PE=3 SV=1 96 441 2.0E-07
sp|Q81PB2|COAW_BACAN Type II pantothenate kinase OS=Bacillus anthracis GN=coaW PE=3 SV=1 94 440 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004594 pantothenate kinase activity Yes
GO:0015937 coenzyme A biosynthetic process Yes
GO:0034033 purine nucleoside bisphosphate biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0008152 metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0017076 purine nucleotide binding No
GO:0016301 kinase activity No
GO:0030554 adenyl nucleotide binding No
GO:0009058 biosynthetic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0018130 heterocycle biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0009987 cellular process No
GO:0006163 purine nucleotide metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0000166 nucleotide binding No
GO:0044238 primary metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0043167 ion binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:0043168 anion binding No
GO:0006164 purine nucleotide biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No
GO:0044281 small molecule metabolic process No
GO:0033875 ribonucleoside bisphosphate metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032553 ribonucleotide binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0032559 adenyl ribonucleotide binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0033865 nucleoside bisphosphate metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0003824 catalytic activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0032555 purine ribonucleotide binding No
GO:0015936 coenzyme A metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034032 purine nucleoside bisphosphate metabolic process No
GO:0036094 small molecule binding No
GO:0006807 nitrogen compound metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0034030 ribonucleoside bisphosphate biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0009260 ribonucleotide biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0033866 nucleoside bisphosphate biosynthetic process No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5287
MILGDMQVAPKSTPGQQPQRHRQLHQQQRPRTMTTTEEIDNTITRPGSVRINVKGAFIVDPDSSSPSMATARSTS
PSHHETSDIRLPNHTAVVSHIAVDIGGSLIKLVYFSREAHSTEPGGRLNFQSFETDRVDDCVELMKHLRDKQLEL
NGSRPGELCVMATGGGAYKFYDKIRDALGVDVSREDEMECLIVGLDFFITEIPREVFTYSETDPMHFVSPRETIY
PYLLVNIGSGVSFLKVTGPRSYQRVGGTSLGGGTLWGLLSLLTGARTFDDMLDQAEQGDNANVDMLVGDIYGTDY
GKIGLKSTAIASSFGKVFRLKSAAEAAGCDFGSSQNDGNAPPTPVSTSAPAGLIPSEAGFTAGDISRSLLYAVSN
NIGQIAYLQSQIHNLSDIYFGGSFIRGHRQTMNTLSYAIKFWSKGEKQAYFLRHEGYLGAVGAFLRRQPMNWGRR
GSFEGAEEASELKRNLRARAGKSQ*
Coding >OphauG2|5287
ATGATCCTTGGCGACATGCAGGTCGCTCCAAAGTCCACACCGGGCCAGCAGCCCCAGCGCCACCGCCAGCTCCAT
CAGCAACAGAGGCCTCGCACAATGACAACAACAGAGGAAATAGATAACACCATTACCAGGCCCGGCAGTGTCCGC
ATCAACGTCAAAGGCGCCTTCATTGTCGACCCTGACTCGTCTTCGCCCTCAATGGCCACTGCTAGAAGCACAAGT
CCTTCTCACCATGAAACGAGCGATATTCGTCTGCCAAATCACACAGCTGTTGTCAGCCACATCGCCGTCGACATT
GGCGGCTCCCTCATCAAACTCGTCTACTTCTCCCGCGAGGCCCATTCTACAGAACCTGGTGGTCGTCTCAACTTC
CAGAGCTTCGAGACGGACCGTGTTGACGACTGCGTCGAGCTCATGAAACATCTGCGGGACAAGCAGCTCGAGCTC
AACGGTTCCCGCCCCGGAGAACTTTGCGTCATGGCCACTGGCGGTGGCGCCTACAAATTCTACGACAAGATCCGT
GACGCTCTGGGAGTCGATGTATCGCGCGAAGATGAGATGGAGTGTCTCATTGTTGGTCTCGACTTCTTCATTACC
GAGATTCCTCGCGAAGTCTTTACCTACTCGGAAACGGACCCTATGCACTTTGTCAGCCCCCGTGAGACCATATAT
CCCTATCTCCTTGTCAATATTGGCTCCGGTGTCTCTTTTCTCAAGGTCACAGGGCCTCGCTCATATCAGCGTGTT
GGCGGCACCTCGCTCGGCGGCGGTACTCTCTGGGGCCTGCTCTCCCTTTTGACTGGTGCTCGCACCTTTGATGAC
ATGCTTGATCAGGCCGAGCAAGGTGACAATGCCAACGTCGACATGCTCGTCGGTGATATCTATGGCACAGACTAT
GGCAAGATTGGCCTCAAAAGTACTGCCATTGCCTCGTCTTTTGGCAAAGTTTTCCGCCTCAAGAGTGCGGCCGAG
GCTGCCGGCTGCGACTTTGGCTCTAGTCAAAATGACGGCAACGCGCCACCAACTCCTGTCTCGACGTCTGCGCCT
GCCGGCCTGATCCCTTCTGAAGCTGGCTTCACAGCCGGCGACATTTCACGCTCATTGCTCTACGCCGTCTCCAAC
AATATCGGTCAAATTGCCTATTTGCAGTCACAGATCCACAACTTGTCCGACATTTACTTTGGCGGCTCCTTCATC
CGTGGCCACAGACAGACAATGAATACGCTCAGCTACGCCATCAAGTTTTGGAGCAAGGGCGAGAAGCAGGCCTAT
TTTTTGCGTCACGAGGGCTATCTTGGTGCTGTGGGCGCCTTTCTAAGAAGACAGCCAATGAACTGGGGCCGCAGA
GGAAGTTTTGAGGGCGCCGAAGAGGCTTCTGAGTTGAAGAGAAACCTAAGAGCCAGGGCTGGCAAGTCTCAGTAA
Transcript >OphauG2|5287
ATGATCCTTGGCGACATGCAGGTCGCTCCAAAGTCCACACCGGGCCAGCAGCCCCAGCGCCACCGCCAGCTCCAT
CAGCAACAGAGGCCTCGCACAATGACAACAACAGAGGAAATAGATAACACCATTACCAGGCCCGGCAGTGTCCGC
ATCAACGTCAAAGGCGCCTTCATTGTCGACCCTGACTCGTCTTCGCCCTCAATGGCCACTGCTAGAAGCACAAGT
CCTTCTCACCATGAAACGAGCGATATTCGTCTGCCAAATCACACAGCTGTTGTCAGCCACATCGCCGTCGACATT
GGCGGCTCCCTCATCAAACTCGTCTACTTCTCCCGCGAGGCCCATTCTACAGAACCTGGTGGTCGTCTCAACTTC
CAGAGCTTCGAGACGGACCGTGTTGACGACTGCGTCGAGCTCATGAAACATCTGCGGGACAAGCAGCTCGAGCTC
AACGGTTCCCGCCCCGGAGAACTTTGCGTCATGGCCACTGGCGGTGGCGCCTACAAATTCTACGACAAGATCCGT
GACGCTCTGGGAGTCGATGTATCGCGCGAAGATGAGATGGAGTGTCTCATTGTTGGTCTCGACTTCTTCATTACC
GAGATTCCTCGCGAAGTCTTTACCTACTCGGAAACGGACCCTATGCACTTTGTCAGCCCCCGTGAGACCATATAT
CCCTATCTCCTTGTCAATATTGGCTCCGGTGTCTCTTTTCTCAAGGTCACAGGGCCTCGCTCATATCAGCGTGTT
GGCGGCACCTCGCTCGGCGGCGGTACTCTCTGGGGCCTGCTCTCCCTTTTGACTGGTGCTCGCACCTTTGATGAC
ATGCTTGATCAGGCCGAGCAAGGTGACAATGCCAACGTCGACATGCTCGTCGGTGATATCTATGGCACAGACTAT
GGCAAGATTGGCCTCAAAAGTACTGCCATTGCCTCGTCTTTTGGCAAAGTTTTCCGCCTCAAGAGTGCGGCCGAG
GCTGCCGGCTGCGACTTTGGCTCTAGTCAAAATGACGGCAACGCGCCACCAACTCCTGTCTCGACGTCTGCGCCT
GCCGGCCTGATCCCTTCTGAAGCTGGCTTCACAGCCGGCGACATTTCACGCTCATTGCTCTACGCCGTCTCCAAC
AATATCGGTCAAATTGCCTATTTGCAGTCACAGATCCACAACTTGTCCGACATTTACTTTGGCGGCTCCTTCATC
CGTGGCCACAGACAGACAATGAATACGCTCAGCTACGCCATCAAGTTTTGGAGCAAGGGCGAGAAGCAGGCCTAT
TTTTTGCGTCACGAGGGCTATCTTGGTGCTGTGGGCGCCTTTCTAAGAAGACAGCCAATGAACTGGGGCCGCAGA
GGAAGTTTTGAGGGCGCCGAAGAGGCTTCTGAGTTGAAGAGAAACCTAAGAGCCAGGGCTGGCAAGTCTCAGTAA
Gene >OphauG2|5287
ATGATCCTTGGCGACATGCAGGTCGCTCCAAAGTCCACACCGGGCCAGCAGCCCCAGCGCCACCGCCAGCTCCAT
CAGCAACAGAGGCCTCGCACAATGACAACAACAGAGGAAATAGATAACACCATTACCAGGCCCGGCAGTGTCCGC
ATCAACGTCAAAGGCGCCTTCATTGTCGACCCTGACTCGTCTTCGCCCTCAATGGCCACTGCTAGAAGCACAAGT
CCTTCTCACCATGAAACGAGCGATATTCGTCTGCCAAATCACACAGCTGTTGTCAGCCACATCGCCGTCGACGTC
TGTCTCCCCCCCGCCCCTCAAAAGAAAAGAACCAAAAAAAAATTTGCTTTGTTGCGGGCCAGCTGACGGCGCTCA
CAGATTGGCGGCTCCCTCATCAAACTCGTCTACTTCTCCCGCGAGGCCCATTCTACAGAACCTGGTGGTCGTCTC
AACTTCCAGAGCTTCGAGACGGACCGTGTTGACGACTGCGTCGAGCTCATGAAACATCTGCGGGACAAGCAGCTC
GAGCTCAACGGTTCCCGCCCCGGAGAACTTTGCGTCATGGCCACTGGCGGTGGCGCCTACAAATTCTACGACAAG
ATCCGTGACGCTCTGGGAGTCGATGTATCGCGCGAAGATGAGATGGAGTGTCTCATTGTTGGTTCGTTTCCCTTC
CACCCCTCCCCCCTCCTGACCTCCCAGGTTCTCGTCTCTTTGACTTACACTTGGCCCTCACCCATAGGTCTCGAC
TTCTTCATTACCGAGATTCCTCGCGAAGTCTTTACCTACTCGGAAACGGACCCTATGCACTTTGTCAGCCCCCGT
GAGACCATATATCCCTATCTCCTTGTCAATATTGGCTCCGGTGTCTCTTTTCTCAAGGTCACAGGGCCTCGCTCA
TATCAGCGTGTTGGCGGCACCTCGCTCGGCGGCGGTACTCTCTGGGGCCTGCTCTCCCTTTTGACTGGTGCTCGC
ACCTTTGATGACATGCTTGATCAGGCCGAGCAAGGTGACAATGCCAACGTCGACATGCTCGTCGGTGATATCTAT
GGCACAGACTATGGCAAGATTGGCCTCAAAAGTACTGCCATTGCCTCGTCTTTTGGCAAAGTTTTCCGCCTCAAG
AGTGCGGCCGAGGCTGCCGGCTGCGACTTTGGCTCTAGTCAAAATGACGGCAACGCGCCACCAACTCCTGTCTCG
ACGTCTGCGCCTGCCGGCCTGATCCCTTCTGAAGCTGGCTTCACAGCCGGCGACATTTCACGCTCATTGCTCTAC
GCCGTCTCCAACAATATCGGTCAAATTGCCTATTTGCAGTCACAGATCCACAACTTGTCCGACATTTACTTTGGC
GGCTCCTTCATCCGTGGCCACAGACAGACAATGAATACGCTCAGCTACGCCATCAAGTTTTGGAGCAAGGGCGAG
AAGCAGGCCTATTTTTTGCGTCACGAGGGCTATCTTGGTGCTGTGGGCGCCTTTCTAAGAAGACAGCCAATGAAC
TGGGGCCGCAGAGGAAGTTTTGAGGGCGCCGAAGAGGCTTCTGAGTTGAAGAGAAACCTAAGAGCCAGGGCTGGC
AAGTCTCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail