Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5284
Gene name
LocationContig_48:12902..17809
Strand+
Gene length (bp)4907
Transcript length (bp)4857
Coding sequence length (bp)4857
Protein length (aa) 1619

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00136 DNA_pol_B DNA polymerase family B 6.2E-98 1054 1500
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 1.7E-10 805 986
PF14260 zf-C4pol C4-type zinc-finger of DNA polymerase delta 2.8E-13 1531 1605

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 645 1607 0.0E+00
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 800 1608 0.0E+00
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 775 1612 0.0E+00
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 775 1612 0.0E+00
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 774 1617 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 645 1607 0.0E+00
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 800 1608 0.0E+00
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 775 1612 0.0E+00
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 775 1612 0.0E+00
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 774 1617 0.0E+00
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 806 1607 3.0E-85
sp|Q54N97|DPOD1_DICDI DNA polymerase delta catalytic subunit OS=Dictyostelium discoideum GN=pold1 PE=3 SV=1 809 1612 9.0E-84
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 877 1613 1.0E-82
sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 806 1613 4.0E-79
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 877 1607 7.0E-79
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 877 1614 1.0E-78
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 877 1607 7.0E-78
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 806 1613 1.0E-77
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 806 1613 3.0E-77
sp|P30315|DPOD1_PLAFK DNA polymerase delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) GN=POLD1 PE=3 SV=1 895 1615 3.0E-77
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 806 1613 5.0E-77
sp|O54747|DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus GN=Pold1 PE=2 SV=1 806 1613 5.0E-76
sp|P90829|DPOD1_CAEEL DNA polymerase delta catalytic subunit OS=Caenorhabditis elegans GN=F10C2.4 PE=3 SV=1 894 1612 4.0E-74
sp|P15436|DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL3 PE=1 SV=4 878 1613 6.0E-70
sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD1 PE=2 SV=1 877 1505 2.0E-67
sp|Q1HVC1|DPOL_EBVA8 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain AG876) GN=BALF5 PE=3 SV=1 877 1462 2.0E-54
sp|Q3KSP1|DPOL_EBVG DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain GD1) GN=BALF5 PE=3 SV=1 877 1462 3.0E-54
sp|P03198|DPOL_EBVB9 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain B95-8) GN=BALF5 PE=1 SV=1 877 1462 3.0E-54
sp|P24907|DPOL_SHV21 DNA polymerase catalytic subunit OS=Saimiriine herpesvirus 2 (strain 11) GN=9 PE=3 SV=1 829 1476 3.0E-51
sp|Q2HRD0|DPOL_HHV8P DNA polymerase catalytic subunit OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF9 PE=3 SV=1 877 1505 8.0E-51
sp|O36363|DPOL_ALHV1 DNA polymerase catalytic subunit OS=Alcelaphine herpesvirus 1 (strain C500) GN=9 PE=3 SV=1 824 1379 2.0E-49
sp|P52367|DPOL_EHV2 DNA polymerase catalytic subunit OS=Equine herpesvirus 2 (strain 86/87) GN=9 PE=3 SV=1 877 1460 3.0E-48
sp|Q9QJ32|DPOL_HHV6Z DNA polymerase catalytic subunit OS=Human herpesvirus 6B (strain Z29) GN=U38 PE=3 SV=1 882 1462 2.0E-46
sp|P28857|DPOL_HHV6U DNA polymerase catalytic subunit OS=Human herpesvirus 6A (strain Uganda-1102) GN=U38 PE=3 SV=1 882 1462 4.0E-46
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 2 433 2.0E-45
sp|P52342|DPOL_HHV7J DNA polymerase catalytic subunit OS=Human herpesvirus 7 (strain JI) GN=U38 PE=3 SV=1 882 1455 1.0E-44
sp|Q9DKT8|DPOL_ELHVK DNA polymerase catalytic subunit OS=Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) PE=3 SV=1 882 1386 5.0E-44
sp|Q69025|DPOL_GPCMV DNA polymerase OS=Guinea pig cytomegalovirus (strain 22122) GN=UL54 PE=3 SV=3 883 1461 2.0E-42
sp|P07918|DPOL_HHV21 DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain 186) GN=UL30 PE=3 SV=1 878 1379 7.0E-41
sp|O71121|DPOL_RHCM6 DNA polymerase catalytic subunit OS=Rhesus cytomegalovirus (strain 68-1) GN=UL54 PE=3 SV=1 883 1393 9.0E-41
sp|P07917|DPOL_HHV1A DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain Angelotti) GN=UL30 PE=1 SV=1 878 1455 2.0E-40
sp|P04293|DPOL_HHV11 DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain 17) GN=UL30 PE=1 SV=2 878 1455 2.0E-40
sp|P09854|DPOL_HHV1S DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain SC16) GN=UL30 PE=3 SV=1 878 1455 2.0E-40
sp|P04292|DPOL_HHV1K DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain KOS) GN=UL30 PE=1 SV=1 878 1455 3.0E-40
sp|P09252|DPOL_VZVD DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Dumas) GN=ORF28 PE=3 SV=1 878 1455 3.0E-40
sp|P89453|DPOL_HHV2H DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain HG52) GN=UL30 PE=3 SV=1 878 1379 3.0E-40
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 3 298 4.0E-40
sp|Q6UDK1|DPOL_PSHV1 DNA polymerase catalytic subunit OS=Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) GN=UL30 PE=3 SV=1 883 1518 4.0E-40
sp|Q4JQU7|DPOL_VZVO DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF28 PE=3 SV=1 878 1455 7.0E-40
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 3 292 4.0E-39
sp|Q9E6N9|DPOL_GAHVM DNA polymerase catalytic subunit OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV043 PE=3 SV=1 826 1379 1.0E-38
sp|Q6S6P1|DPOL_EHV1V DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain V592) GN=30 PE=3 SV=1 878 1455 2.0E-38
sp|P28858|DPOL_EHV1B DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain Ab4p) GN=30 PE=3 SV=1 878 1455 2.0E-38
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 31 285 9.0E-37
sp|Q56366|DPOL_THES9 DNA polymerase OS=Thermococcus sp. (strain 9oN-7) GN=pol PE=1 SV=1 882 1503 1.0E-36
sp|P56689|DPOL_THEGO DNA polymerase OS=Thermococcus gorgonarius GN=pol PE=1 SV=1 882 1503 1.0E-35
sp|Q6SW77|DPOL_HCMVM DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain Merlin) GN=UL54 PE=3 SV=1 1100 1462 2.0E-32
sp|P08546|DPOL_HCMVA DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain AD169) GN=UL54 PE=1 SV=2 1100 1462 2.0E-32
sp|P27172|DPOL_MUHVS DNA polymerase catalytic subunit OS=Murid herpesvirus 1 (strain Smith) GN=UL54 PE=3 SV=1 883 1454 3.0E-32
sp|P30321|DPOL_PBCV1 DNA polymerase OS=Paramecium bursaria Chlorella virus 1 GN=DPO PE=3 SV=2 877 1499 6.0E-32
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 2 198 3.0E-31
sp|P30320|DPOL_PBCVN DNA polymerase OS=Paramecium bursaria Chlorella virus NY2A GN=DPO PE=3 SV=1 877 1499 1.0E-30
sp|P61876|DPOL_PYRWO DNA polymerase OS=Pyrococcus woesei GN=pol PE=1 SV=1 882 1503 3.0E-30
sp|P61875|DPOL_PYRFU DNA polymerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pol PE=1 SV=1 882 1503 3.0E-30
sp|Q196U0|DPOL_IIV3 DNA polymerase 120R OS=Invertebrate iridescent virus 3 GN=IIV3-120R PE=3 SV=1 878 1382 3.0E-30
sp|Q7SIG7|DPOL_DESST DNA polymerase OS=Desulfurococcus sp. (strain Tok) GN=pol PE=1 SV=1 878 1503 4.0E-30
sp|O29753|DPOL_ARCFU DNA polymerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pol PE=3 SV=1 870 1503 8.0E-29
sp|Q85428|DPOL_RCMVM DNA polymerase catalytic subunit OS=Rat cytomegalovirus (strain Maastricht) GN=UL54 PE=3 SV=2 1100 1386 5.0E-28
sp|Q94636|DPOLA_STENO DNA polymerase alpha catalytic subunit OS=Sterkiella nova PE=3 SV=1 884 1499 6.0E-28
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 1008 1501 1.0E-27
sp|P0CL77|DPOL_PYRAB DNA polymerase 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=polI PE=1 SV=1 882 1503 1.0E-27
sp|Q9HH06|DPOL_PYRGL DNA polymerase OS=Pyrococcus glycovorans GN=pol PE=3 SV=1 882 1503 9.0E-27
sp|P0CL76|DPOL_PYRAY DNA polymerase 1 OS=Pyrococcus abyssi GN=polI PE=1 SV=1 882 1503 1.0E-26
sp|O93746|DPOL2_AERPE DNA polymerase 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polB PE=3 SV=3 881 1505 2.0E-25
sp|O70736|DPOL_RSIV DNA polymerase OS=Red sea bream iridovirus PE=3 SV=1 853 1503 2.0E-25
sp|P28040|DPOA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol1 PE=1 SV=1 1099 1552 5.0E-25
sp|O00874|DPOLA_LEIDO DNA polymerase alpha catalytic subunit OS=Leishmania donovani PE=3 SV=1 1099 1599 8.0E-25
sp|O89042|DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus GN=Pola1 PE=2 SV=1 868 1498 1.0E-22
sp|Q27152|DPOLA_OXYTR DNA polymerase alpha catalytic subunit OS=Oxytricha trifallax PE=3 SV=1 1099 1499 1.0E-22
sp|P27727|DPOLA_TRYBB DNA polymerase alpha catalytic subunit OS=Trypanosoma brucei brucei PE=3 SV=1 898 1498 1.0E-22
sp|Q9FHA3|DPOLA_ARATH DNA polymerase alpha catalytic subunit OS=Arabidopsis thaliana GN=POLA PE=3 SV=2 881 1584 1.0E-22
sp|O48653|DPOLA_ORYSJ DNA polymerase alpha catalytic subunit OS=Oryza sativa subsp. japonica GN=Os01g0868300 PE=2 SV=2 871 1498 2.0E-22
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 1177 1523 5.0E-21
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 1177 1523 5.0E-21
sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens GN=POLA1 PE=1 SV=2 868 1498 8.0E-21
sp|P33609|DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus GN=Pola1 PE=1 SV=2 868 1498 1.0E-20
sp|P26019|DPOLA_DROME DNA polymerase alpha catalytic subunit OS=Drosophila melanogaster GN=DNApol-alpha180 PE=1 SV=2 1099 1487 6.0E-20
sp|Q54SV8|DPOLA_DICDI DNA polymerase alpha catalytic subunit OS=Dictyostelium discoideum GN=pola1 PE=3 SV=1 1099 1509 9.0E-19
sp|P52025|DPOL_METVO DNA polymerase OS=Methanococcus voltae GN=pol PE=3 SV=1 884 1503 2.0E-18
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 883 1136 1.0E-17
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 883 1136 1.0E-17
sp|O27276|DPOL1_METTH DNA polymerase PolB subunit 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB1 PE=1 SV=1 806 1292 1.0E-17
sp|Q4U3V0|DPOL_TNAVC DNA polymerase OS=Trichoplusia ni ascovirus 2c GN=ORF1 PE=3 SV=2 1178 1415 2.0E-17
sp|Q9DE46|DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis GN=pola1 PE=1 SV=1 883 1498 3.0E-16
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 1246 1503 3.0E-15
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 1177 1503 5.0E-15
sp|P21189|DPO2_ECOLI DNA polymerase II OS=Escherichia coli (strain K12) GN=polB PE=1 SV=2 847 1459 5.0E-15
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 873 1134 1.0E-14
sp|A4KX57|DPOL_HVAVE DNA polymerase OS=Heliothis virescens ascovirus 3e GN=ORF1 PE=3 SV=1 1183 1415 1.0E-14
sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 11 184 2.0E-13
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 11 184 2.0E-13
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 30 184 6.0E-13
sp|P13382|DPOA_YEAST DNA polymerase alpha catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL1 PE=1 SV=2 1099 1589 6.0E-13
sp|O54747|DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus GN=Pold1 PE=2 SV=1 11 184 1.0E-12
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 1276 1502 1.0E-12
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 11 184 5.0E-12
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 39 184 5.0E-11
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 30 184 6.0E-11
sp|Q779J8|DPOL_SFAVA DNA polymerase OS=Spodoptera frugiperda ascovirus 1a GN=ORF1 PE=3 SV=1 1183 1415 1.0E-10
sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD1 PE=2 SV=1 35 184 2.0E-10
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 882 1256 2.0E-10
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 1241 1503 3.0E-10
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 882 1129 1.0E-09
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 35 184 2.0E-09
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 882 1230 3.0E-09
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 882 1292 5.0E-09
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 882 1230 9.0E-09
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 1241 1503 1.0E-08
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 1276 1540 1.0E-08
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 1278 1503 1.0E-08
sp|Q54N97|DPOD1_DICDI DNA polymerase delta catalytic subunit OS=Dictyostelium discoideum GN=pold1 PE=3 SV=1 31 192 2.0E-08
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 1278 1503 7.0E-08
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 1221 1387 1.0E-07
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 1278 1503 2.0E-07
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 1278 1503 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1955
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5284 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5048
Ophiocordyceps camponoti-floridani Ophcf2|06129
Ophiocordyceps camponoti-rufipedis Ophun1|4257
Ophiocordyceps kimflemingae Ophio5|5018
Ophiocordyceps subramaniannii Hirsu2|2104

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5284
MDFFRVRLNCIDHYQAPQTRYDPQLRNDVGPSQAADGPKVPVVRIFGSTETGQKVCAHIHGAFPYLYIEYPGDLT
WPQAGGFIFGLHLSIDHALAVSYRRDPNGKDGKFVARITLVKGIPFYGFHVGHRLFLKIYLFNPIVISRLADLLL
QGVIMKRKFQPYEAHLQYLLQFMIDYNLYGCDYLNSAKTTFRAPVPQHSQGSNSLHLWHSVSIAQEHITEDASLP
RVSHCSVEVDICVQDIINRRMVKERQLHHDFVERACPVPSTDKLVFSMQGLWNDEAKRRRRKLPQSQQQDNPFPL
EALITMSADSRDSVQQEWVNEKEARAEVCSLIERESASLGEMQVDFATFVRPAEFESSVQTALQSVEHLYPCNLL
PALGLASGSPHDTMDHASTISVDEAKARQAFSQRDYDLVDDDMSDDVLEGVLGSRAESPRKQSVQVAGVTEPHSS
DADSAETDGLWPGTESFSHDASIWNPEPIIEEPRAQATEGGVCSRMQRSNSDALLERQIDSPGHELSEASGNHEE
QPLYESQDKASVFDAAMTQHSKRSQMVLESDGLEIDSKRSRRSPPLRLPNSNGDRADNKPRMRQARQYVSTGKSG
DAVSAATGRHKQQVNDSQVLAQAAKDLCHWQACGPCVTLVYAVMPPSRKDDVTINQDCLADVIYQGPYYGQEEDV
PEESREYAGREFQLGGNTVPFLAEFDTTGLCLICELEPWRARVGVESQEEETASGCSWASWDFEQMPPSRQAVKE
WWCGVTKRREAAAGFKRKVSTALLSQIEGPTPQTKPGLKHAQGAESTSVEDEVQYMSTLSLEVHVNTRGKFLPDP
EEDEIQCLFWACKSDEKAEGGLETASDMQCGMIVLSGDGRIRRQVQRHSQGEVMAESSELDLMVSMVGIVRRLDP
DILTGYEVQSSSWGYLIERARVKYEVDLCKELSRIKTDWQGRIGSKRDSWGFRTTSTIGITGRHTVNIWRAMQGE
AKLQQYSLENVAWQLLGQRVPHYGWATLTQWHKSGRAGDVNKVVRYWQHRARLDLEILEANEVVARTSEQARLLG
VDFFSVFSRGSQFKVESIMFRIAKPENLMLPSPSRKQVGSQPALECLPLVMEPQSGLYTSPVVVLDFQSLYPSVM
IAYNYCYSTCLGRIKDWRGSSRMGFGEYRRQHGLLGLLKEGGIRMAPNGVMYVRAAVRKSLLAKMLTEMLETRIM
IKKSAQDEPDDARLQQRQHNRQLALKLLANVTYGYTSASFSGRMPCSEIADSIVQTGRETLERAIAYIHSQQRWG
GEVVYGDTDSLFVSLRGKTREQAFAIGRDMARAISRMNPQPIKLKFEKVYHPCVLVAKKRYVGYKWEAEEQQQPE
FDAKGIETVRRDGTAAEQRIEEKALRLLFDQADLSQVKAYFQRQCDKIMRGAVSVHDFCFAREVRLGSYSSKGRL
PPGALVSSRRMAEDGRAEPQYRERVPYVVVRGAPGSRLGDRCVAPEELLRNAHWQLDADYYICKTLIAPLDRIFS
LVGANVRQWYDDMPKVQPRGAMRGYMASRQCRVCEAALVDERQHQATCPACDMDAPASLLVLQTNLARQQRSHEQ
LAALCRSCSGLSPLDEVRCDSNDCPVFWSRMRVAARLETMYSA*
Coding >OphauG2|5284
ATGGATTTCTTCCGAGTCCGACTCAACTGCATTGATCACTATCAAGCGCCTCAGACAAGATACGATCCTCAGTTG
CGCAACGATGTTGGCCCTTCCCAGGCAGCCGACGGTCCTAAAGTCCCTGTGGTGAGGATCTTTGGCTCTACGGAA
ACGGGCCAGAAAGTCTGCGCCCACATCCATGGCGCATTCCCGTACCTCTATATTGAGTACCCGGGCGATTTGACT
TGGCCGCAAGCCGGCGGCTTCATCTTTGGTCTGCACCTGTCTATCGACCATGCACTTGCTGTGAGCTATCGGCGC
GACCCGAATGGCAAAGATGGCAAGTTTGTGGCACGCATCACCCTGGTCAAAGGCATTCCCTTTTACGGCTTTCAC
GTCGGCCACCGGCTTTTCTTGAAAATATATCTTTTCAATCCCATTGTAATAAGTCGATTAGCCGACCTTCTTCTT
CAAGGTGTCATCATGAAGCGCAAGTTCCAGCCTTATGAGGCGCACCTTCAGTATCTTCTCCAATTCATGATAGAT
TACAACCTATACGGCTGTGACTATCTCAACTCGGCCAAGACGACCTTTCGCGCTCCTGTGCCTCAACACAGCCAA
GGGTCAAACTCGCTACATCTGTGGCACAGTGTGTCGATTGCCCAAGAGCACATCACGGAAGATGCCTCGTTGCCA
CGTGTCAGCCACTGCTCGGTGGAGGTGGACATTTGCGTGCAAGACATTATTAACCGGAGAATGGTCAAGGAGCGT
CAGTTGCACCATGACTTTGTTGAGCGTGCCTGTCCCGTGCCCAGTACGGATAAGCTGGTTTTCAGTATGCAAGGG
CTGTGGAACGATGAAGCAAAGAGAAGAAGGCGCAAACTGCCGCAGTCTCAGCAACAAGACAATCCTTTCCCTCTA
GAGGCACTGATTACAATGTCTGCCGATAGTCGAGATTCTGTGCAACAGGAATGGGTTAATGAGAAAGAGGCCCGA
GCAGAAGTTTGCAGTCTGATTGAACGAGAGTCTGCGAGTCTGGGCGAGATGCAAGTTGACTTTGCAACTTTTGTC
CGTCCAGCCGAGTTTGAAAGCAGCGTGCAAACAGCTCTGCAATCCGTTGAGCATCTATATCCCTGCAATCTTTTG
CCTGCGTTGGGTCTGGCCTCAGGCTCACCCCATGATACTATGGATCATGCAAGCACCATTTCTGTTGACGAAGCC
AAGGCCCGTCAAGCTTTCTCACAGAGAGATTATGACTTGGTGGATGATGATATGAGTGACGACGTCCTTGAAGGT
GTACTTGGGAGCAGAGCAGAGTCACCTCGGAAACAAAGCGTCCAAGTAGCCGGTGTAACGGAGCCACACAGCAGC
GACGCCGACTCTGCCGAGACGGATGGGCTTTGGCCTGGCACTGAGTCATTTAGTCACGATGCGAGCATCTGGAAC
CCAGAGCCAATTATCGAGGAACCACGGGCGCAGGCTACAGAGGGCGGCGTTTGTAGCAGAATGCAAAGGTCAAAT
AGCGACGCCCTGTTGGAGCGGCAGATTGATTCCCCTGGCCACGAGTTGTCGGAGGCTTCTGGCAACCACGAAGAG
CAGCCTCTTTACGAGTCGCAAGACAAGGCGTCTGTATTTGATGCTGCTATGACACAGCATAGCAAAAGGTCACAA
ATGGTGTTGGAAAGTGATGGCTTAGAGATTGATTCAAAGAGAAGCCGTCGCAGCCCCCCTCTCAGGCTTCCAAAC
AGCAATGGTGACCGGGCGGACAATAAGCCGCGGATGAGACAGGCAAGGCAATATGTTTCTACCGGCAAGAGTGGC
GACGCGGTCTCTGCTGCTACTGGAAGACACAAACAGCAAGTCAATGACTCTCAGGTTTTGGCGCAAGCTGCCAAG
GATTTATGCCACTGGCAGGCTTGTGGGCCTTGTGTTACACTGGTATATGCAGTTATGCCTCCCAGCCGCAAAGAT
GATGTCACAATCAACCAAGATTGTCTGGCCGACGTGATTTATCAAGGGCCGTACTATGGTCAAGAGGAAGATGTT
CCAGAAGAGAGCCGCGAATATGCGGGAAGAGAGTTTCAACTTGGGGGCAACACGGTGCCTTTTCTTGCCGAGTTC
GACACGACCGGATTGTGTTTGATATGCGAGCTGGAACCGTGGAGAGCGAGGGTTGGTGTCGAGAGCCAAGAGGAA
GAGACTGCCTCAGGCTGTAGCTGGGCAAGCTGGGACTTTGAGCAAATGCCGCCCAGCCGTCAGGCCGTCAAGGAA
TGGTGGTGTGGGGTGACTAAGAGACGAGAGGCGGCAGCAGGATTCAAGAGGAAGGTTTCGACGGCCCTGCTGTCA
CAGATTGAAGGCCCAACGCCCCAGACCAAGCCCGGCCTCAAGCACGCGCAGGGAGCGGAAAGCACGAGCGTGGAA
GACGAGGTGCAGTACATGAGCACCTTGAGTCTGGAAGTGCACGTCAATACTCGGGGCAAGTTTCTGCCCGATCCT
GAGGAGGATGAAATCCAGTGTCTCTTTTGGGCATGCAAGTCTGATGAGAAGGCAGAGGGCGGTTTGGAGACGGCG
TCGGACATGCAGTGTGGCATGATTGTGTTGTCGGGAGATGGGCGAATCAGGCGCCAGGTTCAACGGCACAGCCAG
GGCGAGGTGATGGCAGAGAGCTCAGAGCTGGACCTCATGGTCAGCATGGTGGGCATTGTGCGCAGGCTGGACCCA
GACATCTTGACGGGCTACGAGGTGCAGAGCAGCTCATGGGGCTATCTGATTGAGCGGGCCAGGGTCAAGTACGAG
GTGGATCTGTGCAAGGAGCTATCGCGCATCAAGACGGATTGGCAGGGGCGGATTGGCAGCAAGCGCGACAGTTGG
GGCTTCAGGACGACGTCGACGATTGGCATCACGGGGCGTCACACGGTGAATATCTGGAGGGCGATGCAGGGCGAG
GCGAAGCTGCAGCAGTACAGCCTTGAAAACGTGGCGTGGCAGCTGCTAGGGCAGCGAGTGCCGCACTATGGCTGG
GCGACGCTGACGCAGTGGCACAAGAGCGGGCGAGCAGGCGACGTCAACAAGGTGGTGCGGTACTGGCAGCACAGA
GCGCGGCTGGACCTTGAGATTCTCGAGGCCAACGAGGTGGTTGCTCGGACCAGCGAGCAGGCCAGGCTGCTGGGA
GTCGACTTTTTTTCCGTCTTCTCGCGCGGGTCGCAGTTCAAGGTGGAATCCATCATGTTCCGGATCGCCAAGCCG
GAGAACTTGATGCTGCCGTCGCCCAGCAGGAAGCAGGTGGGCTCGCAGCCGGCGCTCGAGTGCCTGCCGCTGGTG
ATGGAGCCGCAGAGCGGGCTGTACACCAGCCCGGTGGTGGTGCTGGATTTCCAGAGCCTGTACCCCAGCGTCATG
ATTGCCTACAACTACTGCTACTCGACGTGTTTGGGGCGCATCAAGGACTGGCGCGGCAGCAGCAGGATGGGGTTT
GGCGAGTACCGGCGGCAGCACGGGCTGCTGGGGCTGCTCAAGGAGGGGGGGATTCGCATGGCGCCCAACGGCGTC
ATGTACGTGAGGGCGGCGGTGCGCAAGTCGCTGCTGGCCAAGATGCTGACGGAGATGCTGGAGACGCGCATCATG
ATCAAGAAGAGCGCCCAGGACGAGCCCGACGACGCGCGGCTGCAGCAGCGGCAGCACAACCGGCAGCTGGCGCTC
AAGCTGCTGGCCAACGTGACGTACGGCTACACGTCGGCGTCGTTCTCGGGACGCATGCCGTGCTCGGAGATTGCC
GACAGCATCGTGCAGACGGGCCGCGAGACGCTGGAGCGGGCCATTGCCTACATCCACTCGCAGCAGCGCTGGGGC
GGCGAGGTGGTGTATGGCGACACGGACAGCCTGTTTGTGTCGCTCCGGGGCAAGACGCGGGAGCAGGCCTTTGCC
ATTGGCCGGGACATGGCGCGGGCCATCAGCCGCATGAACCCCCAGCCCATCAAGCTCAAGTTTGAAAAGGTCTAC
CACCCGTGCGTGCTGGTGGCCAAGAAGCGCTACGTGGGCTACAAGTGGGAGGCGGAGGAGCAGCAGCAGCCCGAG
TTTGACGCCAAGGGCATTGAGACGGTGCGGCGCGACGGCACGGCGGCGGAGCAGCGCATCGAGGAAAAGGCGCTG
CGGCTGCTGTTTGACCAGGCCGACCTGAGCCAGGTCAAGGCCTACTTCCAGCGGCAGTGCGACAAGATTATGCGC
GGCGCCGTGTCGGTGCACGACTTTTGCTTTGCGCGCGAGGTGCGCCTGGGCAGCTACTCCAGCAAGGGCCGGCTG
CCGCCCGGGGCGCTGGTCAGCAGCCGGCGCATGGCCGAGGATGGGCGCGCCGAGCCGCAGTACCGCGAGCGCGTG
CCGTATGTGGTGGTCCGGGGCGCGCCGGGCTCGCGGCTGGGCGACCGCTGCGTGGCGCCCGAGGAGCTGCTGCGC
AACGCGCACTGGCAGCTGGATGCCGACTACTACATTTGCAAGACGCTGATTGCGCCGCTGGACCGCATCTTTAGT
CTTGTGGGCGCCAATGTGCGCCAGTGGTACGACGACATGCCCAAGGTGCAGCCGCGAGGCGCCATGCGAGGCTAC
ATGGCGTCGCGCCAGTGCCGCGTGTGCGAGGCCGCCTTGGTTGACGAGCGCCAGCACCAGGCCACCTGCCCGGCC
TGCGACATGGACGCGCCCGCGTCGCTGCTGGTGCTGCAGACCAACCTGGCCAGGCAGCAGCGCAGCCATGAGCAG
CTTGCTGCCCTGTGCCGCAGCTGTTCGGGGCTGAGTCCTCTGGACGAGGTTCGCTGCGACAGCAACGACTGCCCA
GTCTTTTGGTCGCGGATGCGCGTGGCGGCAAGACTCGAGACCATGTACTCTGCATGA
Transcript >OphauG2|5284
ATGGATTTCTTCCGAGTCCGACTCAACTGCATTGATCACTATCAAGCGCCTCAGACAAGATACGATCCTCAGTTG
CGCAACGATGTTGGCCCTTCCCAGGCAGCCGACGGTCCTAAAGTCCCTGTGGTGAGGATCTTTGGCTCTACGGAA
ACGGGCCAGAAAGTCTGCGCCCACATCCATGGCGCATTCCCGTACCTCTATATTGAGTACCCGGGCGATTTGACT
TGGCCGCAAGCCGGCGGCTTCATCTTTGGTCTGCACCTGTCTATCGACCATGCACTTGCTGTGAGCTATCGGCGC
GACCCGAATGGCAAAGATGGCAAGTTTGTGGCACGCATCACCCTGGTCAAAGGCATTCCCTTTTACGGCTTTCAC
GTCGGCCACCGGCTTTTCTTGAAAATATATCTTTTCAATCCCATTGTAATAAGTCGATTAGCCGACCTTCTTCTT
CAAGGTGTCATCATGAAGCGCAAGTTCCAGCCTTATGAGGCGCACCTTCAGTATCTTCTCCAATTCATGATAGAT
TACAACCTATACGGCTGTGACTATCTCAACTCGGCCAAGACGACCTTTCGCGCTCCTGTGCCTCAACACAGCCAA
GGGTCAAACTCGCTACATCTGTGGCACAGTGTGTCGATTGCCCAAGAGCACATCACGGAAGATGCCTCGTTGCCA
CGTGTCAGCCACTGCTCGGTGGAGGTGGACATTTGCGTGCAAGACATTATTAACCGGAGAATGGTCAAGGAGCGT
CAGTTGCACCATGACTTTGTTGAGCGTGCCTGTCCCGTGCCCAGTACGGATAAGCTGGTTTTCAGTATGCAAGGG
CTGTGGAACGATGAAGCAAAGAGAAGAAGGCGCAAACTGCCGCAGTCTCAGCAACAAGACAATCCTTTCCCTCTA
GAGGCACTGATTACAATGTCTGCCGATAGTCGAGATTCTGTGCAACAGGAATGGGTTAATGAGAAAGAGGCCCGA
GCAGAAGTTTGCAGTCTGATTGAACGAGAGTCTGCGAGTCTGGGCGAGATGCAAGTTGACTTTGCAACTTTTGTC
CGTCCAGCCGAGTTTGAAAGCAGCGTGCAAACAGCTCTGCAATCCGTTGAGCATCTATATCCCTGCAATCTTTTG
CCTGCGTTGGGTCTGGCCTCAGGCTCACCCCATGATACTATGGATCATGCAAGCACCATTTCTGTTGACGAAGCC
AAGGCCCGTCAAGCTTTCTCACAGAGAGATTATGACTTGGTGGATGATGATATGAGTGACGACGTCCTTGAAGGT
GTACTTGGGAGCAGAGCAGAGTCACCTCGGAAACAAAGCGTCCAAGTAGCCGGTGTAACGGAGCCACACAGCAGC
GACGCCGACTCTGCCGAGACGGATGGGCTTTGGCCTGGCACTGAGTCATTTAGTCACGATGCGAGCATCTGGAAC
CCAGAGCCAATTATCGAGGAACCACGGGCGCAGGCTACAGAGGGCGGCGTTTGTAGCAGAATGCAAAGGTCAAAT
AGCGACGCCCTGTTGGAGCGGCAGATTGATTCCCCTGGCCACGAGTTGTCGGAGGCTTCTGGCAACCACGAAGAG
CAGCCTCTTTACGAGTCGCAAGACAAGGCGTCTGTATTTGATGCTGCTATGACACAGCATAGCAAAAGGTCACAA
ATGGTGTTGGAAAGTGATGGCTTAGAGATTGATTCAAAGAGAAGCCGTCGCAGCCCCCCTCTCAGGCTTCCAAAC
AGCAATGGTGACCGGGCGGACAATAAGCCGCGGATGAGACAGGCAAGGCAATATGTTTCTACCGGCAAGAGTGGC
GACGCGGTCTCTGCTGCTACTGGAAGACACAAACAGCAAGTCAATGACTCTCAGGTTTTGGCGCAAGCTGCCAAG
GATTTATGCCACTGGCAGGCTTGTGGGCCTTGTGTTACACTGGTATATGCAGTTATGCCTCCCAGCCGCAAAGAT
GATGTCACAATCAACCAAGATTGTCTGGCCGACGTGATTTATCAAGGGCCGTACTATGGTCAAGAGGAAGATGTT
CCAGAAGAGAGCCGCGAATATGCGGGAAGAGAGTTTCAACTTGGGGGCAACACGGTGCCTTTTCTTGCCGAGTTC
GACACGACCGGATTGTGTTTGATATGCGAGCTGGAACCGTGGAGAGCGAGGGTTGGTGTCGAGAGCCAAGAGGAA
GAGACTGCCTCAGGCTGTAGCTGGGCAAGCTGGGACTTTGAGCAAATGCCGCCCAGCCGTCAGGCCGTCAAGGAA
TGGTGGTGTGGGGTGACTAAGAGACGAGAGGCGGCAGCAGGATTCAAGAGGAAGGTTTCGACGGCCCTGCTGTCA
CAGATTGAAGGCCCAACGCCCCAGACCAAGCCCGGCCTCAAGCACGCGCAGGGAGCGGAAAGCACGAGCGTGGAA
GACGAGGTGCAGTACATGAGCACCTTGAGTCTGGAAGTGCACGTCAATACTCGGGGCAAGTTTCTGCCCGATCCT
GAGGAGGATGAAATCCAGTGTCTCTTTTGGGCATGCAAGTCTGATGAGAAGGCAGAGGGCGGTTTGGAGACGGCG
TCGGACATGCAGTGTGGCATGATTGTGTTGTCGGGAGATGGGCGAATCAGGCGCCAGGTTCAACGGCACAGCCAG
GGCGAGGTGATGGCAGAGAGCTCAGAGCTGGACCTCATGGTCAGCATGGTGGGCATTGTGCGCAGGCTGGACCCA
GACATCTTGACGGGCTACGAGGTGCAGAGCAGCTCATGGGGCTATCTGATTGAGCGGGCCAGGGTCAAGTACGAG
GTGGATCTGTGCAAGGAGCTATCGCGCATCAAGACGGATTGGCAGGGGCGGATTGGCAGCAAGCGCGACAGTTGG
GGCTTCAGGACGACGTCGACGATTGGCATCACGGGGCGTCACACGGTGAATATCTGGAGGGCGATGCAGGGCGAG
GCGAAGCTGCAGCAGTACAGCCTTGAAAACGTGGCGTGGCAGCTGCTAGGGCAGCGAGTGCCGCACTATGGCTGG
GCGACGCTGACGCAGTGGCACAAGAGCGGGCGAGCAGGCGACGTCAACAAGGTGGTGCGGTACTGGCAGCACAGA
GCGCGGCTGGACCTTGAGATTCTCGAGGCCAACGAGGTGGTTGCTCGGACCAGCGAGCAGGCCAGGCTGCTGGGA
GTCGACTTTTTTTCCGTCTTCTCGCGCGGGTCGCAGTTCAAGGTGGAATCCATCATGTTCCGGATCGCCAAGCCG
GAGAACTTGATGCTGCCGTCGCCCAGCAGGAAGCAGGTGGGCTCGCAGCCGGCGCTCGAGTGCCTGCCGCTGGTG
ATGGAGCCGCAGAGCGGGCTGTACACCAGCCCGGTGGTGGTGCTGGATTTCCAGAGCCTGTACCCCAGCGTCATG
ATTGCCTACAACTACTGCTACTCGACGTGTTTGGGGCGCATCAAGGACTGGCGCGGCAGCAGCAGGATGGGGTTT
GGCGAGTACCGGCGGCAGCACGGGCTGCTGGGGCTGCTCAAGGAGGGGGGGATTCGCATGGCGCCCAACGGCGTC
ATGTACGTGAGGGCGGCGGTGCGCAAGTCGCTGCTGGCCAAGATGCTGACGGAGATGCTGGAGACGCGCATCATG
ATCAAGAAGAGCGCCCAGGACGAGCCCGACGACGCGCGGCTGCAGCAGCGGCAGCACAACCGGCAGCTGGCGCTC
AAGCTGCTGGCCAACGTGACGTACGGCTACACGTCGGCGTCGTTCTCGGGACGCATGCCGTGCTCGGAGATTGCC
GACAGCATCGTGCAGACGGGCCGCGAGACGCTGGAGCGGGCCATTGCCTACATCCACTCGCAGCAGCGCTGGGGC
GGCGAGGTGGTGTATGGCGACACGGACAGCCTGTTTGTGTCGCTCCGGGGCAAGACGCGGGAGCAGGCCTTTGCC
ATTGGCCGGGACATGGCGCGGGCCATCAGCCGCATGAACCCCCAGCCCATCAAGCTCAAGTTTGAAAAGGTCTAC
CACCCGTGCGTGCTGGTGGCCAAGAAGCGCTACGTGGGCTACAAGTGGGAGGCGGAGGAGCAGCAGCAGCCCGAG
TTTGACGCCAAGGGCATTGAGACGGTGCGGCGCGACGGCACGGCGGCGGAGCAGCGCATCGAGGAAAAGGCGCTG
CGGCTGCTGTTTGACCAGGCCGACCTGAGCCAGGTCAAGGCCTACTTCCAGCGGCAGTGCGACAAGATTATGCGC
GGCGCCGTGTCGGTGCACGACTTTTGCTTTGCGCGCGAGGTGCGCCTGGGCAGCTACTCCAGCAAGGGCCGGCTG
CCGCCCGGGGCGCTGGTCAGCAGCCGGCGCATGGCCGAGGATGGGCGCGCCGAGCCGCAGTACCGCGAGCGCGTG
CCGTATGTGGTGGTCCGGGGCGCGCCGGGCTCGCGGCTGGGCGACCGCTGCGTGGCGCCCGAGGAGCTGCTGCGC
AACGCGCACTGGCAGCTGGATGCCGACTACTACATTTGCAAGACGCTGATTGCGCCGCTGGACCGCATCTTTAGT
CTTGTGGGCGCCAATGTGCGCCAGTGGTACGACGACATGCCCAAGGTGCAGCCGCGAGGCGCCATGCGAGGCTAC
ATGGCGTCGCGCCAGTGCCGCGTGTGCGAGGCCGCCTTGGTTGACGAGCGCCAGCACCAGGCCACCTGCCCGGCC
TGCGACATGGACGCGCCCGCGTCGCTGCTGGTGCTGCAGACCAACCTGGCCAGGCAGCAGCGCAGCCATGAGCAG
CTTGCTGCCCTGTGCCGCAGCTGTTCGGGGCTGAGTCCTCTGGACGAGGTTCGCTGCGACAGCAACGACTGCCCA
GTCTTTTGGTCGCGGATGCGCGTGGCGGCAAGACTCGAGACCATGTACTCTGCATGA
Gene >OphauG2|5284
ATGGATTTCTTCCGAGTCCGACTCAACTGCATTGATCACTATCAAGCGCCTCAGACAAGATACGATCCTCAGTTG
CGCAACGATGTTGGCCCTTCCCAGGCAGCCGACGGTCCTAAAGTCCCTGTGGTGAGGATCTTTGGCTCTACGGAA
ACGGGCCAGAAAGTCTGCGCCCACATCCATGGCGCATTCCCGTACCTCTATATTGAGTACCCGGGCGATTTGACT
TGGCCGCAAGGTATGATTCTTCAGCTAGCCAACGGTCGCTTGACTGACGTGGTCCCGCAGCCGGCGGCTTCATCT
TTGGTCTGCACCTGTCTATCGACCATGCACTTGCTGTGAGCTATCGGCGCGACCCGAATGGCAAAGATGGCAAGT
TTGTGGCACGCATCACCCTGGTCAAAGGCATTCCCTTTTACGGCTTTCACGTCGGCCACCGGCTTTTCTTGAAAA
TATATCTTTTCAATCCCATTGTAATAAGTCGATTAGCCGACCTTCTTCTTCAAGGTGTCATCATGAAGCGCAAGT
TCCAGCCTTATGAGGCGCACCTTCAGTATCTTCTCCAATTCATGATAGATTACAACCTATACGGCTGTGACTATC
TCAACTCGGCCAAGACGACCTTTCGCGCTCCTGTGCCTCAACACAGCCAAGGGTCAAACTCGCTACATCTGTGGC
ACAGTGTGTCGATTGCCCAAGAGCACATCACGGAAGATGCCTCGTTGCCACGTGTCAGCCACTGCTCGGTGGAGG
TGGACATTTGCGTGCAAGACATTATTAACCGGAGAATGGTCAAGGAGCGTCAGTTGCACCATGACTTTGTTGAGC
GTGCCTGTCCCGTGCCCAGTACGGATAAGCTGGTTTTCAGTATGCAAGGGCTGTGGAACGATGAAGCAAAGAGAA
GAAGGCGCAAACTGCCGCAGTCTCAGCAACAAGACAATCCTTTCCCTCTAGAGGCACTGATTACAATGTCTGCCG
ATAGTCGAGATTCTGTGCAACAGGAATGGGTTAATGAGAAAGAGGCCCGAGCAGAAGTTTGCAGTCTGATTGAAC
GAGAGTCTGCGAGTCTGGGCGAGATGCAAGTTGACTTTGCAACTTTTGTCCGTCCAGCCGAGTTTGAAAGCAGCG
TGCAAACAGCTCTGCAATCCGTTGAGCATCTATATCCCTGCAATCTTTTGCCTGCGTTGGGTCTGGCCTCAGGCT
CACCCCATGATACTATGGATCATGCAAGCACCATTTCTGTTGACGAAGCCAAGGCCCGTCAAGCTTTCTCACAGA
GAGATTATGACTTGGTGGATGATGATATGAGTGACGACGTCCTTGAAGGTGTACTTGGGAGCAGAGCAGAGTCAC
CTCGGAAACAAAGCGTCCAAGTAGCCGGTGTAACGGAGCCACACAGCAGCGACGCCGACTCTGCCGAGACGGATG
GGCTTTGGCCTGGCACTGAGTCATTTAGTCACGATGCGAGCATCTGGAACCCAGAGCCAATTATCGAGGAACCAC
GGGCGCAGGCTACAGAGGGCGGCGTTTGTAGCAGAATGCAAAGGTCAAATAGCGACGCCCTGTTGGAGCGGCAGA
TTGATTCCCCTGGCCACGAGTTGTCGGAGGCTTCTGGCAACCACGAAGAGCAGCCTCTTTACGAGTCGCAAGACA
AGGCGTCTGTATTTGATGCTGCTATGACACAGCATAGCAAAAGGTCACAAATGGTGTTGGAAAGTGATGGCTTAG
AGATTGATTCAAAGAGAAGCCGTCGCAGCCCCCCTCTCAGGCTTCCAAACAGCAATGGTGACCGGGCGGACAATA
AGCCGCGGATGAGACAGGCAAGGCAATATGTTTCTACCGGCAAGAGTGGCGACGCGGTCTCTGCTGCTACTGGAA
GACACAAACAGCAAGTCAATGACTCTCAGGTTTTGGCGCAAGCTGCCAAGGATTTATGCCACTGGCAGGCTTGTG
GGCCTTGTGTTACACTGGTATATGCAGTTATGCCTCCCAGCCGCAAAGATGATGTCACAATCAACCAAGATTGTC
TGGCCGACGTGATTTATCAAGGGCCGTACTATGGTCAAGAGGAAGATGTTCCAGAAGAGAGCCGCGAATATGCGG
GAAGAGAGTTTCAACTTGGGGGCAACACGGTGCCTTTTCTTGCCGAGTTCGACACGACCGGATTGTGTTTGATAT
GCGAGCTGGAACCGTGGAGAGCGAGGGTTGGTGTCGAGAGCCAAGAGGAAGAGACTGCCTCAGGCTGTAGCTGGG
CAAGCTGGGACTTTGAGCAAATGCCGCCCAGCCGTCAGGCCGTCAAGGAATGGTGGTGTGGGGTGACTAAGAGAC
GAGAGGCGGCAGCAGGATTCAAGAGGAAGGTTTCGACGGCCCTGCTGTCACAGATTGAAGGCCCAACGCCCCAGA
CCAAGCCCGGCCTCAAGCACGCGCAGGGAGCGGAAAGCACGAGCGTGGAAGACGAGGTGCAGTACATGAGCACCT
TGAGTCTGGAAGTGCACGTCAATACTCGGGGCAAGTTTCTGCCCGATCCTGAGGAGGATGAAATCCAGTGTCTCT
TTTGGGCATGCAAGTCTGATGAGAAGGCAGAGGGCGGTTTGGAGACGGCGTCGGACATGCAGTGTGGCATGATTG
TGTTGTCGGGAGATGGGCGAATCAGGCGCCAGGTTCAACGGCACAGCCAGGGCGAGGTGATGGCAGAGAGCTCAG
AGCTGGACCTCATGGTCAGCATGGTGGGCATTGTGCGCAGGCTGGACCCAGACATCTTGACGGGCTACGAGGTGC
AGAGCAGCTCATGGGGCTATCTGATTGAGCGGGCCAGGGTCAAGTACGAGGTGGATCTGTGCAAGGAGCTATCGC
GCATCAAGACGGATTGGCAGGGGCGGATTGGCAGCAAGCGCGACAGTTGGGGCTTCAGGACGACGTCGACGATTG
GCATCACGGGGCGTCACACGGTGAATATCTGGAGGGCGATGCAGGGCGAGGCGAAGCTGCAGCAGTACAGCCTTG
AAAACGTGGCGTGGCAGCTGCTAGGGCAGCGAGTGCCGCACTATGGCTGGGCGACGCTGACGCAGTGGCACAAGA
GCGGGCGAGCAGGCGACGTCAACAAGGTGGTGCGGTACTGGCAGCACAGAGCGCGGCTGGACCTTGAGATTCTCG
AGGCCAACGAGGTGGTTGCTCGGACCAGCGAGCAGGCCAGGCTGCTGGGAGTCGACTTTTTTTCCGTCTTCTCGC
GCGGGTCGCAGTTCAAGGTGGAATCCATCATGTTCCGGATCGCCAAGCCGGAGAACTTGATGCTGCCGTCGCCCA
GCAGGAAGCAGGTGGGCTCGCAGCCGGCGCTCGAGTGCCTGCCGCTGGTGATGGAGCCGCAGAGCGGGCTGTACA
CCAGCCCGGTGGTGGTGCTGGATTTCCAGAGCCTGTACCCCAGCGTCATGATTGCCTACAACTACTGCTACTCGA
CGTGTTTGGGGCGCATCAAGGACTGGCGCGGCAGCAGCAGGATGGGGTTTGGCGAGTACCGGCGGCAGCACGGGC
TGCTGGGGCTGCTCAAGGAGGGGGGGATTCGCATGGCGCCCAACGGCGTCATGTACGTGAGGGCGGCGGTGCGCA
AGTCGCTGCTGGCCAAGATGCTGACGGAGATGCTGGAGACGCGCATCATGATCAAGAAGAGCGCCCAGGACGAGC
CCGACGACGCGCGGCTGCAGCAGCGGCAGCACAACCGGCAGCTGGCGCTCAAGCTGCTGGCCAACGTGACGTACG
GCTACACGTCGGCGTCGTTCTCGGGACGCATGCCGTGCTCGGAGATTGCCGACAGCATCGTGCAGACGGGCCGCG
AGACGCTGGAGCGGGCCATTGCCTACATCCACTCGCAGCAGCGCTGGGGCGGCGAGGTGGTGTATGGCGACACGG
ACAGCCTGTTTGTGTCGCTCCGGGGCAAGACGCGGGAGCAGGCCTTTGCCATTGGCCGGGACATGGCGCGGGCCA
TCAGCCGCATGAACCCCCAGCCCATCAAGCTCAAGTTTGAAAAGGTCTACCACCCGTGCGTGCTGGTGGCCAAGA
AGCGCTACGTGGGCTACAAGTGGGAGGCGGAGGAGCAGCAGCAGCCCGAGTTTGACGCCAAGGGCATTGAGACGG
TGCGGCGCGACGGCACGGCGGCGGAGCAGCGCATCGAGGAAAAGGCGCTGCGGCTGCTGTTTGACCAGGCCGACC
TGAGCCAGGTCAAGGCCTACTTCCAGCGGCAGTGCGACAAGATTATGCGCGGCGCCGTGTCGGTGCACGACTTTT
GCTTTGCGCGCGAGGTGCGCCTGGGCAGCTACTCCAGCAAGGGCCGGCTGCCGCCCGGGGCGCTGGTCAGCAGCC
GGCGCATGGCCGAGGATGGGCGCGCCGAGCCGCAGTACCGCGAGCGCGTGCCGTATGTGGTGGTCCGGGGCGCGC
CGGGCTCGCGGCTGGGCGACCGCTGCGTGGCGCCCGAGGAGCTGCTGCGCAACGCGCACTGGCAGCTGGATGCCG
ACTACTACATTTGCAAGACGCTGATTGCGCCGCTGGACCGCATCTTTAGTCTTGTGGGCGCCAATGTGCGCCAGT
GGTACGACGACATGCCCAAGGTGCAGCCGCGAGGCGCCATGCGAGGCTACATGGCGTCGCGCCAGTGCCGCGTGT
GCGAGGCCGCCTTGGTTGACGAGCGCCAGCACCAGGCCACCTGCCCGGCCTGCGACATGGACGCGCCCGCGTCGC
TGCTGGTGCTGCAGACCAACCTGGCCAGGCAGCAGCGCAGCCATGAGCAGCTTGCTGCCCTGTGCCGCAGCTGTT
CGGGGCTGAGTCCTCTGGACGAGGTTCGCTGCGACAGCAACGACTGCCCAGTCTTTTGGTCGCGGATGCGCGTGG
CGGCAAGACTCGAGACCATGTACTCTGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail