Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5280
Gene name
LocationContig_48:4307..7813
Strand-
Gene length (bp)3506
Transcript length (bp)3156
Coding sequence length (bp)3156
Protein length (aa) 1052

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07651 ANTH ANTH domain 3.1E-82 15 276
PF01608 I_LWEQ I/LWEQ domain 1.8E-58 900 1049

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6L5|SLA2_SCHPO Endocytosis protein end4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=end4 PE=1 SV=2 1 1049 0.0E+00
sp|P33338|SLA2_YEAST Protein SLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLA2 PE=1 SV=5 10 274 3.0E-95
sp|O00291|HIP1_HUMAN Huntingtin-interacting protein 1 OS=Homo sapiens GN=HIP1 PE=1 SV=5 18 1049 9.0E-92
sp|Q9JKY5|HIP1R_MOUSE Huntingtin-interacting protein 1-related protein OS=Mus musculus GN=Hip1r PE=1 SV=2 8 1048 4.0E-84
sp|Q8VD75|HIP1_MOUSE Huntingtin-interacting protein 1 OS=Mus musculus GN=Hip1 PE=1 SV=2 18 1049 5.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6L5|SLA2_SCHPO Endocytosis protein end4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=end4 PE=1 SV=2 1 1049 0.0E+00
sp|P33338|SLA2_YEAST Protein SLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLA2 PE=1 SV=5 10 274 3.0E-95
sp|O00291|HIP1_HUMAN Huntingtin-interacting protein 1 OS=Homo sapiens GN=HIP1 PE=1 SV=5 18 1049 9.0E-92
sp|Q9JKY5|HIP1R_MOUSE Huntingtin-interacting protein 1-related protein OS=Mus musculus GN=Hip1r PE=1 SV=2 8 1048 4.0E-84
sp|Q8VD75|HIP1_MOUSE Huntingtin-interacting protein 1 OS=Mus musculus GN=Hip1 PE=1 SV=2 18 1049 5.0E-84
sp|P33338|SLA2_YEAST Protein SLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLA2 PE=1 SV=5 640 1048 3.0E-72
sp|O75146|HIP1R_HUMAN Huntingtin-interacting protein 1-related protein OS=Homo sapiens GN=HIP1R PE=1 SV=2 383 1048 5.0E-54
sp|Q02328|SLAP2_CAEEL Huntington interacting protein related 1 OS=Caenorhabditis elegans GN=hipr-1 PE=3 SV=3 813 1049 6.0E-38
sp|Q02328|SLAP2_CAEEL Huntington interacting protein related 1 OS=Caenorhabditis elegans GN=hipr-1 PE=3 SV=3 19 548 3.0E-28
sp|Q54K81|TALB_DICDI Talin-B OS=Dictyostelium discoideum GN=talB PE=2 SV=1 841 1051 5.0E-26
sp|P0CE95|TALA1_DICDI Talin-A OS=Dictyostelium discoideum GN=talA PE=1 SV=1 653 1050 1.0E-20
sp|Q9Y4G6|TLN2_HUMAN Talin-2 OS=Homo sapiens GN=TLN2 PE=1 SV=4 841 1049 1.0E-20
sp|Q9Y490|TLN1_HUMAN Talin-1 OS=Homo sapiens GN=TLN1 PE=1 SV=3 841 1049 1.0E-19
sp|P26039|TLN1_MOUSE Talin-1 OS=Mus musculus GN=Tln1 PE=1 SV=2 841 1049 2.0E-19
sp|P54939|TLN1_CHICK Talin-1 OS=Gallus gallus GN=TLN1 PE=1 SV=2 841 1049 8.0E-19
sp|Q71LX4|TLN2_MOUSE Talin-2 OS=Mus musculus GN=Tln2 PE=1 SV=3 841 980 1.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0005543 phospholipid binding Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0008289 lipid binding No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1951
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5280 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5044
Ophiocordyceps camponoti-floridani Ophcf2|06134
Ophiocordyceps camponoti-rufipedis Ophun1|7558
Ophiocordyceps kimflemingae Ophio5|5024
Ophiocordyceps subramaniannii Hirsu2|2099

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5280
MTSLRTTEHTKTDQELAISIKKATNSDEISPKRKHVRACIVYTWDHRSSQAFWSGIKVQPILADEVQTFKALITI
HKVLQEGHPSALKEALANRSWIDGLNRGMSGEGVRGYGPLIREYVYYLLAKLAFHQQHPEFNGTFEYEEYLSLKA
INDPNEGYETITDLMILQDKIEVFQKLIFSHFRNVGNNECRISALVPLVQESYGIYKFITSMLRAMHSITGDDEA
LQPLRERYDAQHYRLVKFYYECSNLRYLTSLITIPKLPQDPPNLLAEDDEAPALPARPKQEIERRATPPPEPRSE
EPGDISEFWKSELDRQNREYEEQQRVLEQRQQAALMAQQQAQQDAQREFEEQQRRLMEQQQREQEALLAQQAQWQ
TQGRLADLERENLNARAQYERDQLMLQQYDQRVKSLEGELAQLQNSLGQQITSKDDQIKALQEQVNTWRTKYEAL
AKLYSQLRHEHLDLLQKFKAVQLKAASAQEAIDKREKLEREIKTKNLELADMIRERDRALHDKDRLSGSNKDEVE
RLKRELRMAQDKADQLERSKGNELSTMLAKYNREMSDLEEALRNKSRALEDAQGRLRDGSSDLEQLLREKEEELE
VYKAGMDQTLIELTELKQSQGATDDALDGQIDALILTNLDKINDIIDSVLQAGVSRVDDALYELDSSMQAGNQNA
SPSFVLSQIEKASASAMEFATAFNNFVADGPNSTHSELIKAISVFSGAIADVCSNTKGLTRLATDDKKTDSLMNG
ARQSALSTVHFLRGLQSFRLEGMEALQKTDVVINSNNDVQMNLQKLSKLAETFAPGFGKLARNKGDLGDLVDSEL
SKAADAIAAAAARLAKLRKKPREGYSTYELKVHESILDAATAITDAIGELIRAATVTQQEIVQAGRGSSSRTAFY
KKNNRWTEGLISAAKAVASSTNTLIETADGVLSGRNSPEQLIVASNDVAASTAQLVAASRVKAGFMSKSQEGLEQ
ASKAVGAACRSLVRQVQAMIRERSQDEDQVDYSKLGAHEFKVQEMEQQVEILQLENALSAARHRLGEMRKISYQE
E*
Coding >OphauG2|5280
ATGACCTCGCTGCGCACCACGGAGCATACCAAAACCGATCAAGAGCTTGCCATCAGCATCAAAAAGGCAACCAAC
AGCGACGAGATATCCCCCAAGCGCAAGCATGTGCGCGCCTGCATCGTCTATACCTGGGACCACCGATCTTCGCAG
GCCTTCTGGTCCGGCATCAAGGTCCAGCCCATCCTGGCCGACGAGGTGCAGACGTTCAAGGCACTCATTACCATC
CACAAGGTGCTCCAAGAAGGCCATCCATCAGCCCTCAAGGAGGCACTCGCCAATCGCAGCTGGATCGATGGCCTC
AACCGTGGCATGTCGGGCGAAGGTGTCCGCGGCTACGGCCCCTTGATTCGCGAATACGTCTATTACCTGCTCGCC
AAGTTGGCCTTTCATCAGCAGCACCCTGAATTCAACGGCACCTTTGAATACGAAGAATATCTTAGTCTCAAAGCC
ATCAACGACCCCAACGAGGGCTACGAAACAATCACTGATCTCATGATACTTCAAGACAAGATTGAAGTGTTTCAA
AAGCTCATCTTTTCGCACTTTCGAAATGTTGGCAACAATGAGTGTCGCATCTCGGCTCTTGTGCCCCTGGTACAA
GAGAGCTATGGAATCTACAAGTTCATCACCAGCATGCTCCGAGCTATGCATTCGATCACTGGCGATGATGAAGCC
TTGCAGCCGCTGCGTGAAAGATATGACGCCCAACATTATCGGCTGGTCAAGTTCTACTACGAGTGCTCCAATCTC
CGATATCTCACTAGCCTCATCACCATTCCGAAGCTCCCACAAGATCCTCCAAACCTCCTGGCTGAGGATGATGAA
GCACCTGCTCTTCCTGCTCGACCCAAGCAAGAAATCGAGAGACGGGCGACGCCACCACCGGAACCTCGGTCAGAG
GAACCGGGTGACATATCCGAGTTTTGGAAAAGCGAACTGGACCGGCAGAATCGCGAATATGAGGAACAGCAGCGG
GTGTTGGAACAAAGGCAGCAAGCAGCCCTAATGGCTCAGCAACAAGCTCAGCAAGATGCGCAGCGCGAGTTTGAA
GAACAGCAACGCCGTTTGATGGAGCAGCAGCAGCGTGAGCAAGAGGCGCTTCTGGCACAGCAGGCCCAGTGGCAG
ACACAGGGACGCTTGGCTGATTTGGAGCGCGAGAATTTAAATGCAAGAGCTCAGTACGAAAGAGATCAACTAATG
TTGCAGCAGTATGACCAACGCGTCAAGTCACTTGAAGGCGAATTGGCACAGCTTCAAAACAGCCTTGGCCAGCAA
ATCACGAGCAAAGACGACCAGATTAAGGCTCTCCAAGAACAAGTCAACACTTGGAGGACAAAGTATGAAGCGCTG
GCCAAGCTGTACTCGCAGCTGCGCCATGAGCATCTGGACTTGCTGCAGAAATTCAAGGCTGTGCAGCTCAAGGCG
GCCAGTGCCCAAGAGGCTATTGACAAGCGAGAGAAGCTGGAGCGAGAAATCAAGACCAAGAACCTCGAGCTGGCG
GACATGATTCGCGAGAGGGATCGTGCACTACATGACAAGGACCGACTTAGTGGCAGCAACAAGGACGAGGTTGAA
AGGCTCAAGCGCGAACTGCGCATGGCTCAGGACAAGGCGGACCAGCTGGAGCGTAGCAAAGGCAACGAGCTGTCG
ACAATGCTAGCCAAGTACAACCGCGAAATGAGCGATCTCGAAGAAGCCTTGCGCAACAAGTCTAGGGCTCTCGAG
GATGCGCAGGGACGGCTCCGGGACGGCAGTTCGGACCTGGAGCAGCTCTTACGCGAAAAGGAGGAGGAGCTCGAG
GTGTACAAGGCGGGAATGGACCAGACGCTGATTGAGCTCACGGAGCTCAAGCAGAGCCAGGGAGCGACAGATGAC
GCCTTGGATGGACAGATTGACGCGCTCATCTTGACCAATCTAGACAAGATTAACGACATTATTGACTCTGTGCTG
CAGGCGGGGGTTTCGCGGGTTGATGATGCACTGTACGAGCTGGACTCGTCAATGCAGGCAGGCAATCAAAATGCG
TCGCCGTCGTTTGTGCTTTCGCAGATTGAAAAGGCCTCGGCTAGTGCCATGGAGTTTGCAACGGCCTTTAACAAC
TTTGTCGCCGACGGGCCAAATAGCACGCATTCGGAGCTCATCAAGGCGATTAGTGTCTTTTCGGGGGCCATTGCC
GACGTGTGCAGCAACACAAAGGGCTTGACGAGGCTGGCAACGGACGACAAGAAGACAGATTCGCTGATGAATGGA
GCGCGGCAGTCTGCACTGTCGACGGTACACTTTTTGCGGGGGCTGCAGAGCTTCAGGCTGGAGGGCATGGAGGCG
CTGCAGAAGACGGACGTTGTGATTAATAGCAACAATGATGTGCAGATGAACCTGCAGAAGCTGAGCAAGCTTGCC
GAGACATTTGCGCCCGGGTTTGGCAAGCTTGCGAGAAACAAGGGGGACCTAGGGGACTTGGTGGACTCGGAGCTG
AGCAAGGCTGCTGATGCCATTGCAGCGGCAGCGGCCAGACTGGCCAAGCTTCGCAAGAAGCCTCGAGAGGGATAT
TCGACGTACGAACTCAAGGTACACGAATCAATACTGGACGCAGCGACGGCAATCACAGACGCCATTGGCGAGCTG
ATACGGGCAGCGACGGTGACACAGCAAGAGATTGTGCAGGCGGGGCGCGGGTCATCGTCGCGAACAGCCTTTTAC
AAGAAGAACAACCGGTGGACCGAGGGACTCATCTCGGCGGCCAAGGCGGTGGCGTCATCGACCAACACGCTGATT
GAAACAGCAGACGGAGTGCTGTCGGGTCGAAACAGCCCAGAGCAGCTGATTGTGGCGTCGAATGACGTGGCCGCG
TCGACGGCGCAGCTGGTAGCAGCAAGCCGGGTCAAGGCAGGCTTCATGTCCAAGAGCCAGGAAGGACTGGAGCAG
GCCAGCAAGGCGGTTGGGGCGGCGTGTAGGTCGCTGGTGCGCCAGGTGCAGGCAATGATCCGCGAGCGCAGTCAA
GACGAGGATCAGGTGGACTATTCTAAATTGGGGGCCCACGAGTTTAAGGTGCAGGAAATGGAGCAGCAGGTTGAG
ATTTTGCAGCTGGAGAATGCGCTGAGTGCGGCGCGGCACAGACTGGGGGAGATGCGCAAGATTTCGTACCAGGAG
GAATAG
Transcript >OphauG2|5280
ATGACCTCGCTGCGCACCACGGAGCATACCAAAACCGATCAAGAGCTTGCCATCAGCATCAAAAAGGCAACCAAC
AGCGACGAGATATCCCCCAAGCGCAAGCATGTGCGCGCCTGCATCGTCTATACCTGGGACCACCGATCTTCGCAG
GCCTTCTGGTCCGGCATCAAGGTCCAGCCCATCCTGGCCGACGAGGTGCAGACGTTCAAGGCACTCATTACCATC
CACAAGGTGCTCCAAGAAGGCCATCCATCAGCCCTCAAGGAGGCACTCGCCAATCGCAGCTGGATCGATGGCCTC
AACCGTGGCATGTCGGGCGAAGGTGTCCGCGGCTACGGCCCCTTGATTCGCGAATACGTCTATTACCTGCTCGCC
AAGTTGGCCTTTCATCAGCAGCACCCTGAATTCAACGGCACCTTTGAATACGAAGAATATCTTAGTCTCAAAGCC
ATCAACGACCCCAACGAGGGCTACGAAACAATCACTGATCTCATGATACTTCAAGACAAGATTGAAGTGTTTCAA
AAGCTCATCTTTTCGCACTTTCGAAATGTTGGCAACAATGAGTGTCGCATCTCGGCTCTTGTGCCCCTGGTACAA
GAGAGCTATGGAATCTACAAGTTCATCACCAGCATGCTCCGAGCTATGCATTCGATCACTGGCGATGATGAAGCC
TTGCAGCCGCTGCGTGAAAGATATGACGCCCAACATTATCGGCTGGTCAAGTTCTACTACGAGTGCTCCAATCTC
CGATATCTCACTAGCCTCATCACCATTCCGAAGCTCCCACAAGATCCTCCAAACCTCCTGGCTGAGGATGATGAA
GCACCTGCTCTTCCTGCTCGACCCAAGCAAGAAATCGAGAGACGGGCGACGCCACCACCGGAACCTCGGTCAGAG
GAACCGGGTGACATATCCGAGTTTTGGAAAAGCGAACTGGACCGGCAGAATCGCGAATATGAGGAACAGCAGCGG
GTGTTGGAACAAAGGCAGCAAGCAGCCCTAATGGCTCAGCAACAAGCTCAGCAAGATGCGCAGCGCGAGTTTGAA
GAACAGCAACGCCGTTTGATGGAGCAGCAGCAGCGTGAGCAAGAGGCGCTTCTGGCACAGCAGGCCCAGTGGCAG
ACACAGGGACGCTTGGCTGATTTGGAGCGCGAGAATTTAAATGCAAGAGCTCAGTACGAAAGAGATCAACTAATG
TTGCAGCAGTATGACCAACGCGTCAAGTCACTTGAAGGCGAATTGGCACAGCTTCAAAACAGCCTTGGCCAGCAA
ATCACGAGCAAAGACGACCAGATTAAGGCTCTCCAAGAACAAGTCAACACTTGGAGGACAAAGTATGAAGCGCTG
GCCAAGCTGTACTCGCAGCTGCGCCATGAGCATCTGGACTTGCTGCAGAAATTCAAGGCTGTGCAGCTCAAGGCG
GCCAGTGCCCAAGAGGCTATTGACAAGCGAGAGAAGCTGGAGCGAGAAATCAAGACCAAGAACCTCGAGCTGGCG
GACATGATTCGCGAGAGGGATCGTGCACTACATGACAAGGACCGACTTAGTGGCAGCAACAAGGACGAGGTTGAA
AGGCTCAAGCGCGAACTGCGCATGGCTCAGGACAAGGCGGACCAGCTGGAGCGTAGCAAAGGCAACGAGCTGTCG
ACAATGCTAGCCAAGTACAACCGCGAAATGAGCGATCTCGAAGAAGCCTTGCGCAACAAGTCTAGGGCTCTCGAG
GATGCGCAGGGACGGCTCCGGGACGGCAGTTCGGACCTGGAGCAGCTCTTACGCGAAAAGGAGGAGGAGCTCGAG
GTGTACAAGGCGGGAATGGACCAGACGCTGATTGAGCTCACGGAGCTCAAGCAGAGCCAGGGAGCGACAGATGAC
GCCTTGGATGGACAGATTGACGCGCTCATCTTGACCAATCTAGACAAGATTAACGACATTATTGACTCTGTGCTG
CAGGCGGGGGTTTCGCGGGTTGATGATGCACTGTACGAGCTGGACTCGTCAATGCAGGCAGGCAATCAAAATGCG
TCGCCGTCGTTTGTGCTTTCGCAGATTGAAAAGGCCTCGGCTAGTGCCATGGAGTTTGCAACGGCCTTTAACAAC
TTTGTCGCCGACGGGCCAAATAGCACGCATTCGGAGCTCATCAAGGCGATTAGTGTCTTTTCGGGGGCCATTGCC
GACGTGTGCAGCAACACAAAGGGCTTGACGAGGCTGGCAACGGACGACAAGAAGACAGATTCGCTGATGAATGGA
GCGCGGCAGTCTGCACTGTCGACGGTACACTTTTTGCGGGGGCTGCAGAGCTTCAGGCTGGAGGGCATGGAGGCG
CTGCAGAAGACGGACGTTGTGATTAATAGCAACAATGATGTGCAGATGAACCTGCAGAAGCTGAGCAAGCTTGCC
GAGACATTTGCGCCCGGGTTTGGCAAGCTTGCGAGAAACAAGGGGGACCTAGGGGACTTGGTGGACTCGGAGCTG
AGCAAGGCTGCTGATGCCATTGCAGCGGCAGCGGCCAGACTGGCCAAGCTTCGCAAGAAGCCTCGAGAGGGATAT
TCGACGTACGAACTCAAGGTACACGAATCAATACTGGACGCAGCGACGGCAATCACAGACGCCATTGGCGAGCTG
ATACGGGCAGCGACGGTGACACAGCAAGAGATTGTGCAGGCGGGGCGCGGGTCATCGTCGCGAACAGCCTTTTAC
AAGAAGAACAACCGGTGGACCGAGGGACTCATCTCGGCGGCCAAGGCGGTGGCGTCATCGACCAACACGCTGATT
GAAACAGCAGACGGAGTGCTGTCGGGTCGAAACAGCCCAGAGCAGCTGATTGTGGCGTCGAATGACGTGGCCGCG
TCGACGGCGCAGCTGGTAGCAGCAAGCCGGGTCAAGGCAGGCTTCATGTCCAAGAGCCAGGAAGGACTGGAGCAG
GCCAGCAAGGCGGTTGGGGCGGCGTGTAGGTCGCTGGTGCGCCAGGTGCAGGCAATGATCCGCGAGCGCAGTCAA
GACGAGGATCAGGTGGACTATTCTAAATTGGGGGCCCACGAGTTTAAGGTGCAGGAAATGGAGCAGCAGGTTGAG
ATTTTGCAGCTGGAGAATGCGCTGAGTGCGGCGCGGCACAGACTGGGGGAGATGCGCAAGATTTCGTACCAGGAG
GAATAG
Gene >OphauG2|5280
ATGACCTCGCTGCGCACCACGGAGCATACCAAGTCTGTCGTGCCCATGCTGCCTGTCTGTCCGCAATGGACGCAC
TGATGAGTTTGGCACCCCTAGAACCGATCAAGAGCTTGCCATCAGCATCAAAAAGGCAACCAACAGCGACGAGAT
ATCCCCCAAGCGCAAGCATGTGCGCGCCTGCATCGTCTATACCTGGGACCACCGATCTTCGCAGGCCTTCTGGTC
CGGCATCAAGGTGTATGCCTCTATCCTTGACACCAAGGCGAAGCGCCTCGAACCAACCTTGGGCTGACGTGCTTC
TGCAGCCAGCCCATCCTGGCCGACGAGGTGCAGACGTTCAAGGCACTCATTACCATCCACAAGGTGCTCCAAGAA
GGCCATCCATCAGCCCTCAAGGAGGCACTCGCCAATCGCAGCTGGATCGATGGCCTCAACCGTGGCATGTCGGGC
GAAGGTGTCCGCGGCTACGGCCCCTTGATTCGCGAATACGTCTATTACCTGCTCGCCAAGTTGGCCTTTCATCAG
CAGCACCCTGAATTCAACGGCACCTTTGAATACGAAGAATATCTTAGTCTCAAAGCCATCAACGACCCCAACGAG
GGCTACGAAACAATCACTGATCTCATGATACTTCAAGACAAGATTGAAGTGTTTCAAAAGCTCATCTTTTCGCAC
TTTCGAAATGTTGGCAACAATGAGTGTCGCATCTCGGCTCTTGTGCCCCTGGTACAAGAGAGCTATGGAATCTAC
AAGTTCATCACCAGCATGCTCCGAGCTATGCATTCGAGTAAGTCTTGTGCCCAACCAACTCTGCACCATCAAGGT
AATGACAAGAAAATCAGTCACTGGCGATGATGAAGCCTTGCAGCCGCTGCGTGAAAGATATGACGCCCAACATTA
TCGGCTGGTCAAGTTCTACTACGAGTGCTCCAATCTCCGATATCTCACTAGCCTCATCACCATTCCGAAGCTCCC
ACAAGATCCTCCAAACCTCCTGGCTGAGGATGATGAAGCACCTGCTCTTCCTGCTCGACCCAAGCAAGAAATCGA
GAGACGGGCGACGCCACCACCGGAACCTCGGTCAGAGGAACCGGGTGACATATCCGAGTTTTGGAAAAGCGAACT
GGACCGGCAGAATCGCGAATATGAGGAACAGCAGCGGGTGTTGGAACAAAGGCAGCAAGCAGCCCTAATGGCTCA
GCAACAAGCTCAGCAAGATGCGCAGCGCGAGTTTGAAGAACAGCAACGCCGTTTGATGGAGCAGCAGCAGCGTGA
GCAAGAGGCGCTTCTGGCACAGCAGGCCCAGTGGCAGACACAGGGACGCTTGGCTGATTTGGAGCGCGAGAATTT
AAATGCAAGAGCTCAGTACGAAAGAGATCAACTAATGTTGCAGCAGTATGACCAACGCGTCAAGTCACTTGAAGG
CGAATTGGCACAGCTTCAAAACAGCCTTGGCCAGCAAATCACGAGCAAAGACGACCAGATTAAGGCTCTCCAAGA
ACAAGTCAACACTTGGAGGACAAAGTATGAAGCGCTGGCCAAGCTGTACTCGCAGCTGCGCCATGAGCATCTGGA
CTTGCTGCAGAAATTCAAGGCTGTGCAGCTCAAGGCGGCCAGTGCCCAAGAGGCTATTGACAAGCGAGAGAAGCT
GGAGCGAGAAATCAAGACCAAGAACCTCGAGCTGGCGGACATGATTCGCGAGAGGGATCGTGCACTACATGACAA
GGACCGACTTAGTGGCAGCAACAAGGACGAGGTTGAAAGGCTCAAGCGCGAACTGCGCATGGCTCAGGACAAGGC
GGACCAGCTGGAGCGTAGCAAAGGCAACGAGCTGTCGACAATGCTAGCCAAGTACAACCGCGAAATGAGCGATCT
CGAAGAAGCCTTGCGCAACAAGTCTAGGGCTCTCGAGGATGCGCAGGGACGGCTCCGGGACGGCAGTTCGGACCT
GGAGCAGCTCTTACGCGAAAAGGAGGAGGAGCTCGAGGTGTACAAGGCGGGAATGGACCAGACGCTGATTGAGCT
CACGGAGCTCAAGCAGAGCCAGGGAGCGACAGATGACGCCTTGGATGGACAGATTGACGCGCTCATCTTGACCAA
TCTAGACAAGATTAACGACATTATTGACTCTGTGCTGCAGGCGGGGGTTTCGCGGGTTGATGATGCACTGTACGA
GCTGGACTCGTCAATGCAGGCAGGCAATCAAAATGCGTCGCCGTCGTTTGTGCTTTCGCAGATTGAAAAGGCCTC
GGCTAGTGCCATGGAGTTTGCAACGGCCTTTAACAACTTTGTCGCCGACGGGCCAAATAGCACGCATTCGGAGCT
CATCAAGGCGATTAGTGTCTTTTCGGGGGCCATTGCCGACGTGTGCAGCAACACAAAGGGCTTGACGAGGCTGGC
AACGGACGACAAGAAGACAGATTCGCTGATGAATGGAGCGCGGCAGTCTGCACTGTCGACGGTACACTTTTTGCG
GGGGCTGCAGAGCTTCAGGCTGGAGGGCATGGAGGCGCTGCAGAAGACGGACGTTGTGATTAATAGCAACAATGA
TGTGCAGATGAACCTGCAGAAGCTGAGCAAGCTTGCCGAGACATTTGCGCCCGGGTTTGGCAAGCTTGCGAGAAA
CAAGGGGGACCTAGGGGACTTGGTGGACTCGGAGCTGAGCAAGGCTGCTGATGCCATTGCAGCGGCAGCGGCCAG
ACTGGCCAAGCTTCGCAAGAAGCCTCGAGAGGGATATTCGACGTACGAACTCAAGGTACACGAATCAATACTGGA
CGCAGCGACGGCAATCACAGACGCCATTGGCGAGCTGATACGGGCAGCGACGGTGACACAGCAAGAGATTGTGCA
GGCGGGGCGCGGGTCATCGTCGCGAACAGCCTTTTACAAGAAGAACAACCGGTGGACCGAGGGACTCATCTCGGC
GGCCAAGGCGGTGGCGTCATCGACCAACACGCTGATTGAAACAGCAGACGGAGTGCTGTCGGGTCGAAACAGCCC
AGAGCAGCTGATTGTGGCGTCGAATGACGTGGCCGCGTCGACGGCGCAGCTGGTAGCAGCAAGCCGGGTCAAGGC
AGGCTTCATGTCCAAGAGCCAGGAAGGACTGGAGCAGGCCAGCAAGGCGGTTGGGGCGGCGTGTAGGTCGCTGGT
GCGCCAGGTGCAGGCAATGATCCGCGAGCGCAGTCAAGACGAGGATCAGGTGGACTATTCTAAATTGGGGGCCCA
CGAGTTTAAGGTGCAGGAAATGGAGCAGCAGGTGAGTCTTTTTTTTTTTTGATTTTTTTTTTTTGATTTCTCCCC
CCCTTTGATTTTTTTGCCCCTTTGAGTTTTATTTTGGGTTGGGCGAGTGGTTTCTGGTTGGAGCAAGACGAGAGA
GTGATTGTTTCAAGTTGCTGACGAGGCGCAACGCCATGACACAGGTTGAGATTTTGCAGCTGGAGAATGCGCTGA
GTGCGGCGCGGCACAGACTGGGGGAGATGCGCAAGATTTCGTACCAGGAGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail