Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5256
Gene name
LocationContig_475:10847..14448
Strand-
Gene length (bp)3601
Transcript length (bp)3234
Coding sequence length (bp)3234
Protein length (aa) 1078

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 6.3E-220 129 751
PF08264 Anticodon_1 Anticodon-binding domain of tRNA ligase 2.6E-34 795 943
PF09334 tRNA-synt_1g tRNA synthetases class I (M) 1.2E-05 160 307
PF13603 tRNA-synt_1_2 Leucyl-tRNA synthetase, Domain 2 3.5E-08 377 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28350|SYV_NEUCR Valine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-20 PE=1 SV=1 87 1076 0.0E+00
sp|P07806|SYV_YEAST Valine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAS1 PE=1 SV=2 92 1076 0.0E+00
sp|O75005|SYV_SCHPO Valine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vas2 PE=3 SV=1 29 1000 0.0E+00
sp|P49696|SYVC_TAKRU Valine--tRNA ligase OS=Takifugu rubripes GN=vars PE=3 SV=1 46 1074 0.0E+00
sp|Q04462|SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus GN=Vars PE=2 SV=2 90 1074 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28350|SYV_NEUCR Valine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-20 PE=1 SV=1 87 1076 0.0E+00
sp|P07806|SYV_YEAST Valine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAS1 PE=1 SV=2 92 1076 0.0E+00
sp|O75005|SYV_SCHPO Valine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vas2 PE=3 SV=1 29 1000 0.0E+00
sp|P49696|SYVC_TAKRU Valine--tRNA ligase OS=Takifugu rubripes GN=vars PE=3 SV=1 46 1074 0.0E+00
sp|Q04462|SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus GN=Vars PE=2 SV=2 90 1074 0.0E+00
sp|Q9Z1Q9|SYVC_MOUSE Valine--tRNA ligase OS=Mus musculus GN=Vars PE=1 SV=1 90 1074 0.0E+00
sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens GN=VARS PE=1 SV=4 101 1074 0.0E+00
sp|Q9U1Q4|SYV_CAEEL Valine--tRNA ligase OS=Caenorhabditis elegans GN=vrs-2 PE=1 SV=1 84 1074 0.0E+00
sp|Q86KU2|SYVC_DICDI Probable valine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=valS1 PE=3 SV=1 101 1076 0.0E+00
sp|P93736|SYVM1_ARATH Valine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana GN=TWN2 PE=2 SV=2 61 1060 0.0E+00
sp|Q3U2A8|SYVM_MOUSE Valine--tRNA ligase, mitochondrial OS=Mus musculus GN=Vars2 PE=1 SV=2 48 1051 0.0E+00
sp|Q6MG21|SYVM_RAT Valine--tRNA ligase, mitochondrial OS=Rattus norvegicus GN=Vars2 PE=3 SV=1 48 1077 0.0E+00
sp|Q767M3|SYVM_PIG Valine--tRNA ligase, mitochondrial OS=Sus scrofa GN=VARS2 PE=3 SV=1 48 1074 0.0E+00
sp|Q5ST30|SYVM_HUMAN Valine--tRNA ligase, mitochondrial OS=Homo sapiens GN=VARS2 PE=1 SV=2 48 1031 0.0E+00
sp|Q3JC50|SYV_NITOC Valine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=valS PE=3 SV=1 118 1053 0.0E+00
sp|Q5TM74|SYVM_MACMU Valine--tRNA ligase, mitochondrial OS=Macaca mulatta GN=VARS2 PE=3 SV=2 48 1031 0.0E+00
sp|Q3SL86|SYV_THIDA Valine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|Q606C1|SYV_METCA Valine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|Q2YB22|SYV_NITMU Valine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=valS PE=3 SV=1 118 1055 0.0E+00
sp|Q4KHT9|SYV_PSEF5 Valine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=valS PE=3 SV=1 118 1059 0.0E+00
sp|Q4ZXI0|SYV_PSEU2 Valine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=valS PE=3 SV=1 118 1059 0.0E+00
sp|Q48MF2|SYV_PSE14 Valine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=valS PE=3 SV=1 118 1059 0.0E+00
sp|Q887M3|SYV_PSESM Valine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=valS PE=3 SV=1 118 1059 0.0E+00
sp|Q88P76|SYV_PSEPK Valine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=valS PE=3 SV=1 118 1066 0.0E+00
sp|Q0VSA8|SYV_ALCBS Valine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=valS PE=3 SV=1 118 1074 0.0E+00
sp|Q5WYI0|SYV_LEGPL Valine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=valS PE=3 SV=1 118 1058 0.0E+00
sp|Q5ZXL2|SYV_LEGPH Valine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=valS PE=3 SV=1 118 1058 0.0E+00
sp|Q5X728|SYV_LEGPA Valine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=valS PE=3 SV=1 118 1058 0.0E+00
sp|Q97GG8|SYV_CLOAB Valine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=valS PE=3 SV=1 118 1048 0.0E+00
sp|Q9CMK5|SYV_PASMU Valine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=valS PE=3 SV=1 116 1073 0.0E+00
sp|Q3A253|SYV_PELCD Valine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=valS PE=3 SV=1 118 1060 0.0E+00
sp|Q6F8F0|SYV_ACIAD Valine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q8EBS5|SYV_SHEON Valine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=valS PE=3 SV=1 118 1075 0.0E+00
sp|Q9HXH0|SYV_PSEAE Valine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=valS PE=1 SV=1 118 1059 0.0E+00
sp|Q63TI8|SYV_BURPS Valine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|Q82X51|SYV_NITEU Valine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=valS PE=3 SV=1 118 1073 0.0E+00
sp|Q47BG6|SYV_DECAR Valine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|Q6DA54|SYV_PECAS Valine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=valS PE=3 SV=1 120 1054 0.0E+00
sp|Q4QKA4|SYV_HAEI8 Valine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q67SJ2|SYV_SYMTH Valine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=valS PE=3 SV=1 120 1059 0.0E+00
sp|P43834|SYV_HAEIN Valine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q62KW5|SYV_BURMA Valine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|A5UEN9|SYV_HAEIG Valine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q7MZ25|SYV_PHOLL Valine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=valS PE=3 SV=1 118 1057 0.0E+00
sp|Q87LG6|SYV_VIBPA Valine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=valS PE=3 SV=1 118 1075 0.0E+00
sp|Q891R5|SYV_CLOTE Valine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=valS PE=3 SV=1 118 1046 0.0E+00
sp|Q7MHG1|SYV_VIBVY Valine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=valS PE=3 SV=1 118 1075 0.0E+00
sp|Q8DCE7|SYV_VIBVU Valine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=valS PE=3 SV=1 118 1075 0.0E+00
sp|Q65S97|SYV_MANSM Valine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=valS PE=3 SV=1 120 1059 0.0E+00
sp|Q9KP73|SYV_VIBCH Valine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=valS PE=3 SV=1 118 1075 0.0E+00
sp|Q66F11|SYV_YERPS Valine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=valS PE=3 SV=1 92 1055 0.0E+00
sp|Q3AF87|SYV_CARHZ Valine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=valS PE=3 SV=1 119 1068 0.0E+00
sp|Q0AIF2|SYV_NITEC Valine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=valS PE=3 SV=1 118 1075 0.0E+00
sp|Q488M6|SYV_COLP3 Valine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=valS PE=3 SV=1 118 1057 0.0E+00
sp|Q9X2D7|SYV_THEMA Valine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=valS PE=3 SV=1 120 1041 0.0E+00
sp|A5UBZ9|SYV_HAEIE Valine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q8ZBH1|SYV_YERPE Valine--tRNA ligase OS=Yersinia pestis GN=valS PE=3 SV=1 92 1055 0.0E+00
sp|Q5NHZ4|SYV_FRATT Valine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=valS PE=3 SV=1 118 1074 0.0E+00
sp|Q8RHK3|SYV_FUSNN Valine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=valS PE=3 SV=1 118 1073 0.0E+00
sp|Q8RBN5|SYV_CALS4 Valine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=valS PE=3 SV=1 118 991 0.0E+00
sp|Q474E1|SYV_CUPPJ Valine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=valS PE=3 SV=1 118 1059 0.0E+00
sp|Q83DD0|SYV_COXBU Valine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=valS PE=3 SV=1 118 1055 0.0E+00
sp|B0BR94|SYV_ACTPJ Valine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|A3N2F0|SYV_ACTP2 Valine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|B3GYI3|SYV_ACTP7 Valine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q54I78|SYVM_DICDI Probable valine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=valS2 PE=3 SV=2 119 946 0.0E+00
sp|Q57GC5|SYV_SALCH Valine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=valS PE=3 SV=1 118 1066 0.0E+00
sp|C1D6J9|SYV_LARHH Valine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|Q5NXL5|SYV_AROAE Valine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=valS PE=3 SV=1 118 1055 0.0E+00
sp|Q5PJB8|SYV_SALPA Valine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|Q8Z118|SYV_SALTI Valine--tRNA ligase OS=Salmonella typhi GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|Q6LUW1|SYV_PHOPR Valine--tRNA ligase OS=Photobacterium profundum GN=valS PE=3 SV=2 118 1075 0.0E+00
sp|Q8SS27|SYVC_ENCCU Probable valine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_1140 PE=3 SV=1 118 971 0.0E+00
sp|Q5E7U0|SYV_VIBF1 Valine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=valS PE=3 SV=1 118 1072 0.0E+00
sp|A8F8Q3|SYV_PSELT Valine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q4FQL0|SYV_PSYA2 Valine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=valS PE=3 SV=1 95 1075 0.0E+00
sp|Q8ZK31|SYV_SALTY Valine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|Q83IM5|SYV_SHIFL Valine--tRNA ligase OS=Shigella flexneri GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|Q3YU91|SYV_SHISS Valine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|Q31TK0|SYV_SHIBS Valine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|Q8XCB3|SYV_ECO57 Valine--tRNA ligase OS=Escherichia coli O157:H7 GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|Q7W6P3|SYV_BORPA Valine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=valS PE=3 SV=1 118 1077 0.0E+00
sp|Q8FAD1|SYV_ECOL6 Valine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|B0USP0|SYV_HISS2 Valine--tRNA ligase OS=Histophilus somni (strain 2336) GN=valS PE=3 SV=1 120 1073 0.0E+00
sp|B7GH39|SYV_ANOFW Valine--tRNA ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=valS PE=3 SV=1 120 1073 0.0E+00
sp|P07118|SYV_ECOLI Valine--tRNA ligase OS=Escherichia coli (strain K12) GN=valS PE=1 SV=2 118 1054 0.0E+00
sp|A1K9L8|SYV_AZOSB Valine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=valS PE=3 SV=1 118 1055 0.0E+00
sp|Q7WHM6|SYV_BORBR Valine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=valS PE=3 SV=1 118 1055 0.0E+00
sp|Q74BJ6|SYV_GEOSL Valine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=valS PE=3 SV=1 118 1074 0.0E+00
sp|Q7NUM8|SYV_CHRVO Valine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|Q5QY15|SYV_IDILO Valine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=valS PE=3 SV=1 118 1073 0.0E+00
sp|Q7VN93|SYV_HAEDU Valine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q328S3|SYV_SHIDS Valine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|Q3II73|SYV_PSEHT Valine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|Q7VWK6|SYV_BORPE Valine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=valS PE=3 SV=1 118 1055 0.0E+00
sp|A7HJX5|SYV_FERNB Valine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q3Z9C5|SYV_DEHM1 Valine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|Q6MQK8|SYV_BDEBA Valine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=valS PE=3 SV=1 120 1072 0.0E+00
sp|Q8XJ42|SYV_CLOPE Valine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=valS PE=3 SV=1 119 1061 0.0E+00
sp|Q8XX80|SYV_RALSO Valine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=valS PE=3 SV=1 118 1077 0.0E+00
sp|Q5N3J4|SYV_SYNP6 Valine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=valS PE=3 SV=1 120 1060 0.0E+00
sp|Q65GK8|SYV_BACLD Valine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|A6SUQ8|SYV_JANMA Valine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|P11931|SYV_GEOSE Valine--tRNA ligase OS=Geobacillus stearothermophilus GN=valS PE=1 SV=1 120 1056 0.0E+00
sp|Q5KWL3|SYV_GEOKA Valine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q05873|SYV_BACSU Valine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=valS PE=1 SV=3 120 1053 0.0E+00
sp|A9BIJ7|SYV_PETMO Valine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=valS PE=3 SV=1 118 1071 0.0E+00
sp|A4G1V2|SYV_HERAR Valine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|Q3ZZG9|SYV_DEHMC Valine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|Q9K1H7|SYV_NEIMB Valine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q74JZ8|SYV_LACJO Valine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q72ZW8|SYV_BACC1 Valine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q5F5W0|SYV_NEIG1 Valine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q9JX22|SYV_NEIMA Valine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q81LD3|SYV_BACAN Valine--tRNA ligase OS=Bacillus anthracis GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q6HD68|SYV_BACHK Valine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q8EPN2|SYV_OCEIH Valine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q633Y6|SYV_BACCZ Valine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q817R6|SYV_BACCR Valine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|B2FMS2|SYV_STRMK Valine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=valS PE=3 SV=1 119 1056 0.0E+00
sp|F4KE63|SYVM2_ARATH Valine--tRNA ligase, chloroplastic/mitochondrial 2 OS=Arabidopsis thaliana GN=EMB2247 PE=3 SV=1 118 1058 0.0E+00
sp|B4SJ70|SYV_STRM5 Valine--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=valS PE=3 SV=1 119 1056 0.0E+00
sp|Q5WEQ4|SYV_BACSK Valine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=valS PE=3 SV=1 120 1072 0.0E+00
sp|B0RVI4|SYV_XANCB Valine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=valS PE=3 SV=1 119 1056 0.0E+00
sp|Q55522|SYV_SYNY3 Valine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=valS PE=3 SV=1 120 1071 0.0E+00
sp|Q7A0P4|SYV_STAAW Valine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|A8Z2I4|SYV_STAAT Valine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q6G8R2|SYV_STAAS Valine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q99TJ8|SYV_STAAN Valine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=valS PE=1 SV=1 120 1075 0.0E+00
sp|A6QHJ8|SYV_STAAE Valine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q5HFA8|SYV_STAAC Valine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|A5ITI8|SYV_STAA9 Valine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q2FXR8|SYV_STAA8 Valine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q2FG72|SYV_STAA3 Valine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|A6U2D1|SYV_STAA2 Valine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q8PCR7|SYV_XANCP Valine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=valS PE=3 SV=1 119 1056 0.0E+00
sp|Q4UQP3|SYV_XANC8 Valine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=valS PE=3 SV=1 119 1056 0.0E+00
sp|Q931Q1|SYV_STAAM Valine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|A7X383|SYV_STAA1 Valine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q82ZW6|SYV_ENTFA Valine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q6GG42|SYV_STAAR Valine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q8PGQ7|SYV_XANAC Valine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=valS PE=3 SV=1 119 1056 0.0E+00
sp|Q9K8G8|SYV_BACHD Valine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=valS PE=3 SV=1 120 1072 0.0E+00
sp|Q8CS83|SYV_STAES Valine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q5HNN9|SYV_STAEQ Valine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|B9DND4|SYV_STACT Valine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q2YTA0|SYV_STAAB Valine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q8YX97|SYV_NOSS1 Valine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=valS PE=3 SV=1 120 1015 0.0E+00
sp|Q72E47|SYV_DESVH Valine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=valS PE=3 SV=1 113 1058 0.0E+00
sp|Q49Y96|SYV_STAS1 Valine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=valS PE=3 SV=1 120 1066 0.0E+00
sp|Q6G2V3|SYV_BARHE Valine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=valS PE=3 SV=1 118 1058 0.0E+00
sp|Q92BG2|SYV_LISIN Valine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q7TUI9|SYV_PROMM Valine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=valS PE=3 SV=2 114 1022 0.0E+00
sp|Q7U3N4|SYV_SYNPX Valine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=valS PE=3 SV=1 118 1019 0.0E+00
sp|Q73MZ2|SYV_TREDE Valine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=valS PE=3 SV=1 118 1075 0.0E+00
sp|Q5H4N5|SYV_XANOR Valine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=valS PE=3 SV=1 119 1056 0.0E+00
sp|B2SPF0|SYV_XANOP Valine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=valS PE=3 SV=1 119 1056 0.0E+00
sp|Q38XD1|SYV_LACSS Valine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q8Y6X9|SYV_LISMO Valine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q4L703|SYV_STAHJ Valine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q2P7G5|SYV_XANOM Valine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=valS PE=3 SV=1 119 1056 0.0E+00
sp|Q71ZB6|SYV_LISMF Valine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q5FKW5|SYV_LACAC Valine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q3BP98|SYV_XANC5 Valine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=valS PE=3 SV=1 119 1056 0.0E+00
sp|Q7V9I9|SYV_PROMA Valine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=valS PE=3 SV=1 114 1057 0.0E+00
sp|Q46IA7|SYV_PROMT Valine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=valS PE=3 SV=1 118 1048 0.0E+00
sp|Q8DIS8|SYV_THEEB Valine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=valS PE=3 SV=1 120 1041 0.0E+00
sp|Q87F36|SYV_XYLFT Valine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|B2I6K9|SYV_XYLF2 Valine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=valS PE=3 SV=1 118 1054 0.0E+00
sp|C4V924|SYVC_NOSCE Probable valine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_101032 PE=3 SV=1 119 935 0.0E+00
sp|Q9PH12|SYV_XYLFA Valine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|Q88UX7|SYV_LACPL Valine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q6FZB1|SYV_BARQU Valine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=valS PE=3 SV=1 118 1058 0.0E+00
sp|Q01PF1|SYV_SOLUE Valine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|B0U1L1|SYV_XYLFM Valine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=valS PE=3 SV=1 119 1056 0.0E+00
sp|Q8G0Y3|SYV_BRUSU Valine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=valS PE=3 SV=1 152 1033 0.0E+00
sp|Q92Q37|SYV_RHIME Valine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=valS PE=3 SV=1 118 1073 0.0E+00
sp|Q8YGX8|SYV_BRUME Valine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=valS PE=3 SV=1 118 1033 0.0E+00
sp|Q4JWU8|SYV_CORJK Valine--tRNA ligase OS=Corynebacterium jeikeium (strain K411) GN=valS PE=3 SV=1 119 1061 0.0E+00
sp|Q9A8N3|SYV_CAUCR Valine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=valS PE=3 SV=1 118 1038 0.0E+00
sp|A5V592|SYV_SPHWW Valine--tRNA ligase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=valS PE=3 SV=1 118 1033 0.0E+00
sp|Q6AMA0|SYV_DESPS Valine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=valS PE=3 SV=1 118 1038 0.0E+00
sp|Q9CDP6|SYV_LACLA Valine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=valS PE=3 SV=1 120 1060 0.0E+00
sp|Q6N6N1|SYV_RHOPA Valine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=valS PE=3 SV=1 118 1033 0.0E+00
sp|P9WFS9|SYV_MYCTU Valine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=valS PE=1 SV=2 118 1019 0.0E+00
sp|P9WFS8|SYV_MYCTO Valine--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=valS PE=3 SV=2 118 1019 0.0E+00
sp|P67600|SYV_MYCBO Valine--tRNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=valS PE=3 SV=2 118 1019 0.0E+00
sp|O06851|SYV_STRCO Valine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=valS PE=3 SV=2 120 1060 0.0E+00
sp|Q9CBY7|SYV_MYCLE Valine--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=valS PE=3 SV=1 118 1055 0.0E+00
sp|Q8FN65|SYV_COREF Valine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=valS PE=3 SV=2 118 1060 0.0E+00
sp|Q5NLA8|SYV_ZYMMO Valine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=valS PE=3 SV=3 118 1054 0.0E+00
sp|Q7NCQ9|SYV_GLOVI Valine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=valS PE=3 SV=1 120 1073 0.0E+00
sp|Q3SSP4|SYV_NITWN Valine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=valS PE=3 SV=1 118 1038 0.0E+00
sp|Q8UEN6|SYV_AGRFC Valine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|P36420|SYV_LACCA Valine--tRNA ligase OS=Lactobacillus casei GN=valS PE=3 SV=2 120 1075 0.0E+00
sp|Q98LB1|SYV_RHILO Valine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=valS PE=3 SV=1 118 1058 0.0E+00
sp|Q8NN37|SYV_CORGL Valine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=valS PE=3 SV=2 118 1071 0.0E+00
sp|Q73XN8|SYV_MYCPA Valine--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=valS PE=3 SV=1 118 1060 0.0E+00
sp|Q89LR8|SYV_BRADU Valine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=valS PE=3 SV=1 118 1038 0.0E+00
sp|P96142|SYV_THETH Valine--tRNA ligase OS=Thermus thermophilus GN=valS PE=1 SV=2 118 1071 0.0E+00
sp|Q5SJ45|SYV_THET8 Valine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=valS PE=3 SV=1 118 1071 0.0E+00
sp|Q72V30|SYV_LEPIC Valine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=valS PE=3 SV=1 120 1054 0.0E+00
sp|P57447|SYV_BUCAI Valine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=valS PE=3 SV=1 118 1074 0.0E+00
sp|Q6NFV0|SYV_CORDI Valine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=valS PE=3 SV=1 118 903 0.0E+00
sp|Q8E1B5|SYV_STRA5 Valine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|A6Q3R4|SYV_NITSB Valine--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=valS PE=3 SV=1 120 1059 0.0E+00
sp|Q72JG7|SYV_THET2 Valine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=valS PE=3 SV=1 118 1071 0.0E+00
sp|Q3K2S4|SYV_STRA1 Valine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q4FM20|SYV_PELUB Valine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=valS PE=3 SV=1 120 969 0.0E+00
sp|Q8EZT8|SYV_LEPIN Valine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=valS PE=3 SV=2 120 1054 0.0E+00
sp|Q5M5J8|SYV_STRT2 Valine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=valS PE=3 SV=2 120 1053 0.0E+00
sp|Q5Z048|SYV_NOCFA Valine--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=valS PE=3 SV=1 110 903 0.0E+00
sp|Q82CA3|SYV_STRAW Valine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=valS PE=3 SV=1 120 1060 0.0E+00
sp|Q97S45|SYV_STRPN Valine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=valS PE=3 SV=1 120 1053 0.0E+00
sp|Q99YS1|SYV_STRP1 Valine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q48SA4|SYV_STRPM Valine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|P0DG65|SYV_STRPQ Valine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|P0DG64|SYV_STRP3 Valine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q493Z9|SYV_BLOPB Valine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|Q5M111|SYV_STRT1 Valine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=valS PE=3 SV=2 120 1053 0.0E+00
sp|Q8P040|SYV_STRP8 Valine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q8KC74|SYV_CHLTE Valine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=valS PE=3 SV=1 118 1058 0.0E+00
sp|Q89AG3|SYV_BUCBP Valine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=valS PE=3 SV=1 118 1056 0.0E+00
sp|Q5XAW8|SYV_STRP6 Valine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q8DQU7|SYV_STRR6 Valine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|O83998|SYV_TREPA Valine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=valS PE=3 SV=1 120 1063 0.0E+00
sp|Q8DSL1|SYV_STRMU Valine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=valS PE=3 SV=1 120 1074 0.0E+00
sp|Q7M8H7|SYV_WOLSU Valine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=valS PE=3 SV=1 118 1058 0.0E+00
sp|Q7VHN2|SYV_HELHP Valine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=valS PE=3 SV=1 118 1060 0.0E+00
sp|Q8K9I1|SYV_BUCAP Valine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=valS PE=3 SV=1 118 1074 0.0E+00
sp|Q0BTM1|SYV_GRABC Valine--tRNA ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=valS PE=3 SV=1 118 1071 0.0E+00
sp|Q9RY06|SYV_DEIRA Valine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=valS PE=3 SV=1 120 1056 0.0E+00
sp|Q8E6S0|SYV_STRA3 Valine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=valS PE=3 SV=1 120 1075 0.0E+00
sp|Q7UZI3|SYV_PROMP Valine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=valS PE=3 SV=1 120 1041 0.0E+00
sp|Q5FN28|SYV_GLUOX Valine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=valS PE=3 SV=1 118 1055 0.0E+00
sp|Q6MAM1|SYV_PARUW Valine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=valS PE=3 SV=1 118 1060 0.0E+00
sp|O51680|SYV_BORBU Valine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=valS PE=3 SV=1 120 1038 0.0E+00
sp|B9KMT9|SYV_RHOSK Valine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=valS PE=3 SV=1 118 1074 0.0E+00
sp|A3PHJ6|SYV_RHOS1 Valine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=valS PE=3 SV=1 118 1021 0.0E+00
sp|Q3J4Z5|SYV_RHOS4 Valine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=valS PE=3 SV=1 118 1021 0.0E+00
sp|Q660D6|SYV_BORBP Valine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=valS PE=3 SV=1 120 1038 0.0E+00
sp|A6LIG7|SYV_PARD8 Valine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=valS PE=3 SV=1 120 1068 0.0E+00
sp|Q7X2N3|SYV_SPHEL Valine--tRNA ligase OS=Sphingomonas elodea GN=valS PE=3 SV=1 118 930 3.0E-180
sp|Q9ZK61|SYV_HELPJ Valine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=valS PE=3 SV=1 119 931 3.0E-178
sp|Q1GUM2|SYV_SPHAL Valine--tRNA ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=valS PE=3 SV=1 118 1033 8.0E-178
sp|P56000|SYV_HELPY Valine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=valS PE=3 SV=1 119 931 2.0E-177
sp|Q7MVD7|SYV_PORGI Valine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=valS PE=3 SV=1 120 1075 8.0E-177
sp|B2RK53|SYV_PORG3 Valine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=valS PE=3 SV=1 120 1075 2.0E-176
sp|Q5LP30|SYV_RUEPO Valine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=valS PE=3 SV=1 118 1074 5.0E-175
sp|Q64XH6|SYV_BACFR Valine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=valS PE=3 SV=1 120 1074 6.0E-175
sp|Q5LGN1|SYV_BACFN Valine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=valS PE=3 SV=1 120 1074 6.0E-175
sp|B3ETM6|SYV_AMOA5 Valine--tRNA ligase OS=Amoebophilus asiaticus (strain 5a2) GN=valS PE=3 SV=1 120 1057 2.0E-174
sp|Q7VQT2|SYV_BLOFL Valine--tRNA ligase OS=Blochmannia floridanus GN=valS PE=3 SV=1 118 1052 2.0E-174
sp|Q89ZM4|SYV_BACTN Valine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=valS PE=3 SV=1 120 1073 6.0E-173
sp|Q9PK91|SYV_CHLMU Valine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=valS PE=3 SV=1 118 1068 1.0E-172
sp|Q5HV17|SYV_CAMJR Valine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=valS PE=3 SV=1 125 929 5.0E-171
sp|Q9PPE4|SYV_CAMJE Valine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=valS PE=3 SV=1 125 929 1.0E-170
sp|Q822K4|SYV_CHLCV Valine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=valS PE=3 SV=1 113 1071 3.0E-168
sp|Q6F1B1|SYV_MESFL Valine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=valS PE=3 SV=1 120 973 4.0E-167
sp|Q7UXH9|SYV_RHOBA Valine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=valS PE=3 SV=2 155 1075 2.0E-166
sp|Q5L5J6|SYV_CHLAB Valine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=valS PE=3 SV=1 113 1071 2.0E-166
sp|Q255D3|SYV_CHLFF Valine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=valS PE=3 SV=1 113 1071 1.0E-164
sp|B0BBT3|SYV_CHLTB Valine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=valS PE=3 SV=1 118 886 1.0E-163
sp|B0B7L8|SYV_CHLT2 Valine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=valS PE=3 SV=1 118 886 1.0E-163
sp|Q9Z987|SYV_CHLPN Valine--tRNA ligase OS=Chlamydia pneumoniae GN=valS PE=3 SV=1 118 1071 2.0E-162
sp|A0M5I5|SYV_GRAFK Valine--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=valS PE=3 SV=1 120 1020 6.0E-161
sp|O84304|SYV_CHLTR Valine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=valS PE=3 SV=1 118 886 6.0E-161
sp|Q3KM60|SYV_CHLTA Valine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=valS PE=3 SV=1 118 886 7.0E-161
sp|Q8D294|SYV_WIGBR Valine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=valS PE=3 SV=1 120 943 4.0E-160
sp|A6L3G7|SYV_BACV8 Valine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=valS PE=3 SV=1 120 1073 1.0E-159
sp|O14160|SYVM_SCHPO Valine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vas1 PE=3 SV=2 109 1040 1.0E-158
sp|Q6MTU2|SYV_MYCMS Valine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=valS PE=3 SV=1 120 941 9.0E-157
sp|Q9PQM4|SYV_UREPA Valine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=valS PE=3 SV=1 118 903 3.0E-148
sp|Q4A6B0|SYV_MYCS5 Valine--tRNA ligase OS=Mycoplasma synoviae (strain 53) GN=valS PE=3 SV=1 155 929 9.0E-143
sp|Q6YRJ6|SYV_ONYPE Valine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=valS PE=3 SV=2 120 914 7.0E-140
sp|Q5ZZL4|SYV_MYCH2 Valine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=valS PE=3 SV=1 120 940 3.0E-134
sp|P46216|SYV_TRIVA Valine--tRNA ligase (Fragment) OS=Trichomonas vaginalis GN=VALS PE=3 SV=1 200 681 4.0E-134
sp|Q4A755|SYV_MYCH7 Valine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=valS PE=3 SV=1 120 940 1.0E-133
sp|Q4A917|SYV_MYCHJ Valine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=valS PE=3 SV=1 120 940 2.0E-133
sp|Q8EX08|SYV_MYCPE Valine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=valS PE=3 SV=2 154 1074 2.0E-131
sp|Q6KID2|SYV_MYCMO Valine--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=valS PE=3 SV=1 155 889 2.0E-130
sp|P75304|SYV_MYCPN Valine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=valS PE=3 SV=1 120 931 1.0E-127
sp|P47576|SYV_MYCGE Valine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=valS PE=3 SV=1 111 955 2.0E-127
sp|Q98QV4|SYV_MYCPU Valine--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=valS PE=3 SV=1 155 884 5.0E-123
sp|Q7NAR7|SYV_MYCGA Valine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=valS PE=3 SV=2 152 1060 3.0E-122
sp|Q8TVG5|SYV_METKA Valine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=valS PE=3 SV=1 114 976 3.0E-93
sp|O67411|SYV_AQUAE Valine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=valS PE=3 SV=1 117 513 5.0E-93
sp|O28059|SYV_ARCFU Valine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=valS PE=3 SV=1 118 982 5.0E-90
sp|Q58413|SYV_METJA Valine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=valS PE=3 SV=1 155 950 5.0E-89
sp|Q5JGN7|SYV_THEKO Valine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=valS PE=3 SV=1 118 980 1.0E-87
sp|O58052|SYV_PYRHO Valine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=valS PE=3 SV=2 118 943 3.0E-87
sp|Q9UY55|SYV_PYRAB Valine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=valS PE=3 SV=1 118 980 4.0E-87
sp|Q8U409|SYV_PYRFU Valine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=valS PE=3 SV=1 118 943 1.0E-86
sp|O26861|SYV_METTH Valine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=valS PE=3 SV=2 126 941 4.0E-84
sp|O67411|SYV_AQUAE Valine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=valS PE=3 SV=1 591 1052 7.0E-84
sp|Q9HMG9|SYV_HALSA Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=valS PE=3 SV=1 119 943 8.0E-82
sp|B0R841|SYV_HALS3 Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=valS PE=3 SV=1 119 943 8.0E-82
sp|Q5V1H0|SYV_HALMA Valine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=valS PE=3 SV=1 102 978 1.0E-81
sp|Q46B32|SYV_METBF Valine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=valS PE=3 SV=1 118 941 6.0E-81
sp|Q8TLI4|SYV_METAC Valine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=valS PE=3 SV=1 118 941 9.0E-80
sp|Q8Q024|SYV_METMA Valine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=valS PE=3 SV=1 118 955 1.0E-79
sp|Q3IUE5|SYV_NATPD Valine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=valS PE=3 SV=1 119 887 2.0E-79
sp|Q6LZP0|SYV_METMP Valine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=valS PE=3 SV=1 155 943 2.0E-77
sp|A0B7C2|SYV_METTP Valine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=valS PE=3 SV=1 118 886 3.0E-76
sp|Q4J8X1|SYV_SULAC Valine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=valS PE=3 SV=1 118 980 6.0E-76
sp|Q972A3|SYV_SULTO Valine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=valS PE=3 SV=2 118 976 2.0E-75
sp|Q1RJ74|SYV_RICBR Valine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=valS PE=3 SV=1 118 968 2.0E-67
sp|A8GVS7|SYV_RICB8 Valine--tRNA ligase OS=Rickettsia bellii (strain OSU 85-389) GN=valS PE=3 SV=1 118 968 1.0E-66
sp|A4J2F4|SYI_DESRM Isoleucine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=ileS PE=3 SV=1 132 921 1.0E-65
sp|Q8R9L3|SYI_CALS4 Isoleucine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=ileS PE=3 SV=1 148 926 8.0E-65
sp|Q9ZCN6|SYV_RICPR Valine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=valS PE=3 SV=1 118 955 1.0E-64
sp|C3PLG3|SYV_RICAE Valine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=valS PE=3 SV=1 118 886 1.0E-64
sp|A5CCE0|SYV_ORITB Valine--tRNA ligase OS=Orientia tsutsugamushi (strain Boryong) GN=valS PE=3 SV=1 120 883 1.0E-64
sp|Q68W50|SYV_RICTY Valine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=valS PE=3 SV=1 118 955 1.0E-64
sp|Q4UMX8|SYV_RICFE Valine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=valS PE=3 SV=1 118 886 1.0E-64
sp|B2A2I8|SYI_NATTJ Isoleucine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ileS PE=3 SV=1 155 923 6.0E-64
sp|Q97ZK9|SYV_SULSO Valine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=valS PE=3 SV=1 118 957 7.0E-64
sp|Q92GR9|SYV_RICCN Valine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=valS PE=3 SV=1 118 886 2.0E-63
sp|Q6L1N5|SYV_PICTO Valine--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=valS PE=3 SV=1 125 946 3.0E-63
sp|A8GTB4|SYV_RICRS Valine--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=valS PE=3 SV=1 118 886 4.0E-63
sp|B0BUV1|SYV_RICRO Valine--tRNA ligase OS=Rickettsia rickettsii (strain Iowa) GN=valS PE=3 SV=1 118 886 4.0E-63
sp|C4K2L1|SYV_RICPU Valine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=valS PE=3 SV=1 118 886 4.0E-63
sp|A8EZQ5|SYV_RICCK Valine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=valS PE=3 SV=1 118 953 4.0E-63
sp|A8F465|SYI_PSELT Isoleucine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ileS PE=3 SV=1 154 980 7.0E-63
sp|Q0AYC7|SYI_SYNWW Isoleucine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=ileS PE=3 SV=1 150 923 1.0E-62
sp|Q9YAZ0|SYV_AERPE Valine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=valS PE=3 SV=3 156 886 2.0E-62
sp|Q8ZVG2|SYV_PYRAE Valine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=valS PE=3 SV=1 133 884 2.0E-62
sp|B9MRZ5|SYI_CALBD Isoleucine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ileS PE=3 SV=1 126 909 3.0E-62
sp|Q5HC99|SYV_EHRRW Valine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=valS PE=3 SV=1 132 944 1.0E-61
sp|Q97CR9|SYV_THEVO Valine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=valS PE=3 SV=1 125 961 2.0E-61
sp|C5CHA1|SYI_KOSOT Isoleucine--tRNA ligase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ileS PE=3 SV=1 148 996 2.0E-61
sp|Q5FF72|SYV_EHRRG Valine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=valS PE=3 SV=1 132 944 3.0E-61
sp|B8CWL4|SYI_HALOH Isoleucine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ileS PE=3 SV=1 132 911 5.0E-61
sp|Q8TWY2|SYI_METKA Isoleucine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ileS PE=3 SV=1 148 1015 8.0E-61
sp|Q5P9M8|SYV_ANAMM Valine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=valS PE=3 SV=1 108 842 1.0E-60
sp|B0K2W1|SYI_THEPX Isoleucine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=ileS PE=3 SV=1 148 926 2.0E-60
sp|B0K8R7|SYI_THEP3 Isoleucine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=ileS PE=3 SV=1 148 926 2.0E-60
sp|A4XKR2|SYI_CALS8 Isoleucine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=ileS PE=3 SV=1 126 914 2.0E-60
sp|A8GPJ3|SYV_RICAH Valine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=valS PE=3 SV=1 143 886 3.0E-60
sp|O27428|SYI_METTH Isoleucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ileS PE=3 SV=3 118 926 3.0E-60
sp|Q9HM29|SYV_THEAC Valine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=valS PE=3 SV=1 125 943 2.0E-59
sp|Q2RK59|SYI_MOOTA Isoleucine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=ileS PE=3 SV=1 147 922 3.0E-59
sp|A3CSI6|SYI_METMJ Isoleucine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ileS PE=3 SV=1 119 929 3.0E-59
sp|Q3YT16|SYV_EHRCJ Valine--tRNA ligase OS=Ehrlichia canis (strain Jake) GN=valS PE=3 SV=1 148 886 8.0E-59
sp|O29622|SYI_ARCFU Isoleucine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ileS PE=3 SV=1 120 926 1.0E-58
sp|P26499|SYI_METTM Isoleucine--tRNA ligase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=ileS PE=1 SV=3 118 938 3.0E-58
sp|A7IAM2|SYI_METB6 Isoleucine--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=ileS PE=3 SV=1 115 929 5.0E-58
sp|Q45477|SYI_BACSU Isoleucine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=ileS PE=3 SV=3 133 989 1.0E-57
sp|B9K8X3|SYI_THENN Isoleucine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=ileS PE=3 SV=1 155 922 1.0E-57
sp|C1EPQ9|SYI_BACC3 Isoleucine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=ileS PE=3 SV=1 155 967 2.0E-57
sp|Q9K9V0|SYI_BACHD Isoleucine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ileS PE=3 SV=1 155 990 2.0E-57
sp|Q3AEP2|SYI_CARHZ Isoleucine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=ileS PE=3 SV=1 155 923 2.0E-57
sp|P46213|SYI_THEMA Isoleucine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ileS PE=3 SV=2 155 922 2.0E-57
sp|Q12ZD1|SYI_METBU Isoleucine--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=ileS PE=3 SV=1 120 930 2.0E-57
sp|A5IML2|SYI_THEP1 Isoleucine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=ileS PE=3 SV=1 155 922 3.0E-57
sp|Q47NK0|SYV_THEFY Valine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=valS PE=3 SV=1 107 962 3.0E-57
sp|B7H6N1|SYI_BACC4 Isoleucine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=ileS PE=3 SV=1 155 914 3.0E-57
sp|Q819R4|SYI1_BACCR Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ileS1 PE=3 SV=1 155 914 3.0E-57
sp|C0QP76|SYI_PERMH Isoleucine--tRNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=ileS PE=3 SV=1 155 922 4.0E-57
sp|A9BI29|SYI_PETMO Isoleucine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ileS PE=3 SV=1 155 946 4.0E-57
sp|Q6HER9|SYI1_BACHK Isoleucine--tRNA ligase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ileS1 PE=3 SV=1 155 914 6.0E-57
sp|B7JJY2|SYI_BACC0 Isoleucine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=ileS PE=3 SV=1 155 914 1.0E-56
sp|B7IUQ5|SYI_BACC2 Isoleucine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=ileS PE=3 SV=1 155 904 1.0E-56
sp|A9VTD5|SYI_BACWK Isoleucine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=ileS PE=3 SV=1 155 908 2.0E-56
sp|Q8TN62|SYI_METAC Isoleucine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ileS PE=3 SV=1 150 930 2.0E-56
sp|Q732H4|SYI1_BACC1 Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ileS1 PE=3 SV=1 155 904 4.0E-56
sp|Q636D1|SYI1_BACCZ Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ZK / E33L) GN=ileS1 PE=3 SV=1 155 904 4.0E-56
sp|C3L730|SYI_BACAC Isoleucine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ileS PE=3 SV=1 155 914 6.0E-56
sp|C3P665|SYI_BACAA Isoleucine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=ileS PE=3 SV=1 155 914 6.0E-56
sp|Q81WE4|SYI1_BACAN Isoleucine--tRNA ligase 1 OS=Bacillus anthracis GN=ileS1 PE=3 SV=1 155 914 6.0E-56
sp|B1I4A3|SYI_DESAP Isoleucine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=ileS PE=3 SV=1 148 922 1.0E-55
sp|P46214|SYI_PYRFU Isoleucine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=ileS PE=3 SV=2 112 1011 2.0E-55
sp|B5RN32|SYI_BORDL Isoleucine--tRNA ligase OS=Borrelia duttonii (strain Ly) GN=ileS PE=3 SV=1 155 993 3.0E-55
sp|Q65JV7|SYI_BACLD Isoleucine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ileS PE=3 SV=1 155 984 3.0E-55
sp|B9IVX2|SYI_BACCQ Isoleucine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=ileS PE=3 SV=1 155 904 3.0E-55
sp|B7HLM9|SYI_BACC7 Isoleucine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=ileS PE=3 SV=1 155 904 3.0E-55
sp|C0R112|SYI_BRAHW Isoleucine--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=ileS PE=3 SV=1 133 922 5.0E-55
sp|Q8PSV9|SYI_METMA Isoleucine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=ileS PE=3 SV=1 120 930 6.0E-55
sp|B2V9T1|SYI_SULSY Isoleucine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=ileS PE=3 SV=1 155 923 7.0E-55
sp|A2SPV6|SYI_METLZ Isoleucine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=ileS PE=3 SV=1 118 921 9.0E-55
sp|B5RQH0|SYI_BORRA Isoleucine--tRNA ligase OS=Borrelia recurrentis (strain A1) GN=ileS PE=3 SV=1 155 993 2.0E-54
sp|Q747X9|SYI_GEOSL Isoleucine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ileS PE=3 SV=1 147 905 2.0E-54
sp|Q5GRK0|SYV_WOLTR Valine--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=valS PE=3 SV=1 150 934 2.0E-54
sp|Q73HS9|SYV_WOLPM Valine--tRNA ligase OS=Wolbachia pipientis wMel GN=valS PE=3 SV=1 153 934 2.0E-54
sp|Q67Q27|SYI_SYMTH Isoleucine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ileS PE=3 SV=1 132 923 3.0E-54
sp|Q9V072|SYI_PYRAB Isoleucine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ileS PE=3 SV=1 112 976 4.0E-54
sp|C0ZG86|SYI_BREBN Isoleucine--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=ileS PE=3 SV=1 133 907 5.0E-54
sp|Q5L0V9|SYI_GEOKA Isoleucine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=ileS PE=3 SV=1 155 904 6.0E-54
sp|C5D8P2|SYI_GEOSW Isoleucine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=ileS PE=3 SV=1 155 904 7.0E-54
sp|Q3A1R3|SYI_PELCD Isoleucine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ileS PE=3 SV=1 133 977 9.0E-54
sp|O58792|SYI_PYRHO Isoleucine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ileS PE=3 SV=1 112 983 1.0E-53
sp|A7GRM0|SYI_BACCN Isoleucine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ileS PE=3 SV=1 155 967 1.0E-53
sp|B7IGT1|SYI_THEAB Isoleucine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=ileS PE=3 SV=1 155 922 3.0E-53
sp|A0B7P3|SYI_METTP Isoleucine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=ileS PE=3 SV=1 120 928 3.0E-53
sp|A7HMY6|SYI_FERNB Isoleucine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=ileS PE=3 SV=1 132 904 4.0E-53
sp|Q6AK45|SYI_DESPS Isoleucine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=ileS PE=3 SV=1 133 922 4.0E-53
sp|A4IM25|SYI_GEOTN Isoleucine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ileS PE=3 SV=1 155 904 5.0E-53
sp|Q739A1|SYI2_BACC1 Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ileS2 PE=3 SV=1 152 939 5.0E-53
sp|A1R0Q9|SYI_BORT9 Isoleucine--tRNA ligase OS=Borrelia turicatae (strain 91E135) GN=ileS PE=3 SV=1 155 938 9.0E-53
sp|Q81E30|SYI2_BACCR Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ileS2 PE=3 SV=2 152 939 1.0E-52
sp|Q465G4|SYI_METBF Isoleucine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=ileS PE=3 SV=1 150 928 1.0E-52
sp|O66651|SYI_AQUAE Isoleucine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=ileS PE=3 SV=1 155 922 2.0E-52
sp|A0RDG3|SYI_BACAH Isoleucine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=ileS PE=3 SV=1 152 939 3.0E-52
sp|Q63BZ8|SYI2_BACCZ Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ZK / E33L) GN=ileS2 PE=3 SV=1 152 939 3.0E-52
sp|B8HMX3|SYI_CYAP4 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ileS PE=3 SV=1 155 887 6.0E-52
sp|Q81R75|SYI2_BACAN Isoleucine--tRNA ligase 2 OS=Bacillus anthracis GN=ileS2 PE=3 SV=1 152 939 6.0E-52
sp|B2S1H8|SYI_BORHD Isoleucine--tRNA ligase OS=Borrelia hermsii (strain HS1 / DAH) GN=ileS PE=3 SV=1 155 992 6.0E-52
sp|A6LK77|SYI_THEM4 Isoleucine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=ileS PE=3 SV=1 155 922 7.0E-52
sp|Q9XDB4|SYI_FERPD Isoleucine--tRNA ligase OS=Fervidobacterium pennivorans (strain DSM 9078 / Ven5) GN=ileS PE=3 SV=3 132 947 9.0E-52
sp|Q5UZ84|SYI_HALMA Isoleucine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ileS PE=3 SV=1 120 911 1.0E-51
sp|Q65ZU1|SYI_BORBP Isoleucine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=ileS PE=3 SV=1 155 938 1.0E-51
sp|Q74NF3|SYV_NANEQ Valine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=valS PE=3 SV=1 120 886 2.0E-51
sp|Q6HJF2|SYI2_BACHK Isoleucine--tRNA ligase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ileS2 PE=3 SV=1 152 939 3.0E-51
sp|Q8ET99|SYI2_OCEIH Isoleucine--tRNA ligase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ileS2 PE=3 SV=1 154 939 3.0E-51
sp|O51773|SYI_BORBU Isoleucine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=ileS PE=3 SV=1 155 1054 4.0E-51
sp|A8FSI2|SYI_SHESH Isoleucine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=ileS PE=3 SV=1 115 971 6.0E-51
sp|A6W346|SYI_MARMS Isoleucine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=ileS PE=3 SV=1 154 961 8.0E-51
sp|B7J0S6|SYI_BORBZ Isoleucine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=ileS PE=3 SV=1 155 1054 8.0E-51
sp|Q72JR6|SYI_THET2 Isoleucine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ileS PE=3 SV=2 132 954 1.0E-50
sp|Q0SM18|SYI_BORAP Isoleucine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=ileS PE=3 SV=1 155 938 2.0E-50
sp|Q24TH1|SYI_DESHY Isoleucine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=ileS PE=3 SV=1 133 910 2.0E-50
sp|Q899C3|SYI_CLOTE Isoleucine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=ileS PE=3 SV=2 123 939 2.0E-50
sp|B8FT35|SYI_DESHD Isoleucine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=ileS PE=3 SV=1 133 910 2.0E-50
sp|B7KFT1|SYI_CYAP7 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=ileS PE=3 SV=1 153 889 2.0E-50
sp|P56690|SYI_THET8 Isoleucine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ileS PE=1 SV=2 132 954 3.0E-50
sp|Q3ITY7|SYI_NATPD Isoleucine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ileS PE=3 SV=1 120 921 3.0E-50
sp|Q8XHE4|SYI_CLOPE Isoleucine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=ileS PE=3 SV=1 123 955 5.0E-50
sp|Q1LSS9|SYI_BAUCH Isoleucine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=ileS PE=3 SV=1 154 934 5.0E-50
sp|Q18GW3|SYI_HALWD Isoleucine--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ileS PE=3 SV=1 120 906 6.0E-50
sp|A5EWT0|SYI_DICNV Isoleucine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=ileS PE=3 SV=1 132 922 6.0E-50
sp|Q5JJ31|SYI_THEKO Isoleucine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=ileS PE=3 SV=1 112 983 6.0E-50
sp|B8CSC1|SYI_SHEPW Isoleucine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ileS PE=3 SV=1 150 985 9.0E-50
sp|Q4FPA9|SYI_PELUB Isoleucine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=ileS PE=3 SV=1 115 913 1.0E-49
sp|Q605M7|SYI_METCA Isoleucine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ileS PE=3 SV=1 155 902 1.0E-49
sp|B1KIT5|SYI_SHEWM Isoleucine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ileS PE=3 SV=1 155 887 2.0E-49
sp|Q8L1B1|SYI2_PSEFL Isoleucine--tRNA ligase 2 OS=Pseudomonas fluorescens GN=ileS2 PE=1 SV=3 124 931 2.0E-49
sp|B2IZP5|SYI_NOSP7 Isoleucine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ileS PE=3 SV=1 153 907 3.0E-49
sp|Q0HFY9|SYI_SHESM Isoleucine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=ileS PE=3 SV=1 155 887 3.0E-49
sp|Q0HS82|SYI_SHESR Isoleucine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=ileS PE=3 SV=1 155 887 3.0E-49
sp|Q7VDV0|SYI_PROMA Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ileS PE=3 SV=1 147 894 4.0E-49
sp|A0KZZ1|SYI_SHESA Isoleucine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=ileS PE=3 SV=1 155 887 4.0E-49
sp|B5FA60|SYI_VIBFM Isoleucine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=ileS PE=3 SV=1 154 987 4.0E-49
sp|B8GQR1|SYI_THISH Isoleucine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=ileS PE=3 SV=1 155 1002 7.0E-49
sp|B9DPP7|SYI_STACT Isoleucine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=ileS PE=3 SV=1 148 904 7.0E-49
sp|B1WVA3|SYI_CYAA5 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=ileS PE=3 SV=1 155 887 7.0E-49
sp|Q8DGI7|SYI_THEEB Isoleucine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=ileS PE=3 SV=2 155 887 8.0E-49
sp|Q6MKX0|SYI_BDEBA Isoleucine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ileS PE=3 SV=1 126 930 8.0E-49
sp|Q8NX29|SYI_STAAW Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=ileS PE=3 SV=1 148 972 9.0E-49
sp|Q6GA19|SYI_STAAS Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=ileS PE=3 SV=1 148 972 9.0E-49
sp|C6BV89|SYI_DESAD Isoleucine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=ileS PE=3 SV=1 115 954 9.0E-49
sp|B0TJA9|SYI_SHEHH Isoleucine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=ileS PE=3 SV=1 150 892 9.0E-49
sp|B6EMY6|SYI_ALISL Isoleucine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=ileS PE=3 SV=1 115 987 1.0E-48
sp|Q5E7N4|SYI_VIBF1 Isoleucine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ileS PE=3 SV=1 154 987 1.0E-48
sp|Q2YXH4|SYI_STAAB Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ileS PE=3 SV=1 148 972 1.0E-48
sp|A8Z3N1|SYI_STAAT Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ileS PE=3 SV=1 148 972 2.0E-48
sp|P67509|SYI_STAAN Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=ileS PE=1 SV=1 148 972 2.0E-48
sp|P67508|SYI_STAAM Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ileS PE=3 SV=1 148 972 2.0E-48
sp|A6QG93|SYI_STAAE Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=ileS PE=3 SV=1 148 972 2.0E-48
sp|Q5HGN8|SYI_STAAC Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=ileS PE=3 SV=1 148 972 2.0E-48
sp|A5IS79|SYI_STAA9 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=ileS PE=3 SV=1 148 972 2.0E-48
sp|Q2FZ82|SYI_STAA8 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=ileS PE=3 SV=1 148 972 2.0E-48
sp|Q2FHP4|SYI_STAA3 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=ileS PE=3 SV=1 148 972 2.0E-48
sp|A6U113|SYI_STAA2 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=ileS PE=3 SV=1 148 972 2.0E-48
sp|A7X1D8|SYI_STAA1 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ileS PE=3 SV=1 148 972 2.0E-48
sp|A7FMD7|SYI_YERP3 Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ileS PE=3 SV=1 132 887 2.0E-48
sp|Q7MNM8|SYI_VIBVY Isoleucine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=ileS PE=3 SV=1 154 916 3.0E-48
sp|Q8DES7|SYI_VIBVU Isoleucine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=ileS PE=3 SV=1 154 916 3.0E-48
sp|P73505|SYI_SYNY3 Isoleucine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ileS PE=3 SV=1 155 887 3.0E-48
sp|A1JJE1|SYI_YERE8 Isoleucine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ileS PE=3 SV=1 132 890 4.0E-48
sp|Q03QI3|SYI_LACBA Isoleucine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ileS PE=3 SV=1 143 975 4.0E-48
sp|Q72AR5|SYI_DESVH Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ileS PE=3 SV=1 133 967 4.0E-48
sp|A1VCU3|SYI_DESVV Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ileS PE=3 SV=1 133 982 5.0E-48
sp|A6WKD4|SYI_SHEB8 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=ileS PE=3 SV=1 155 887 5.0E-48
sp|Q6GHP2|SYI_STAAR Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=ileS PE=3 SV=1 148 972 6.0E-48
sp|P41972|SYI1_STAAU Isoleucine--tRNA ligase OS=Staphylococcus aureus GN=ileS PE=1 SV=1 148 972 6.0E-48
sp|B8EFC7|SYI_SHEB2 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=ileS PE=3 SV=1 155 887 6.0E-48
sp|Q8YXY3|SYI_NOSS1 Isoleucine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ileS PE=3 SV=1 153 962 7.0E-48
sp|A3D1G5|SYI_SHEB5 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ileS PE=3 SV=1 155 887 1.0E-47
sp|B7K5H5|SYI_CYAP8 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=ileS PE=3 SV=1 155 889 1.0E-47
sp|A9L4U7|SYI_SHEB9 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=ileS PE=3 SV=1 155 887 1.0E-47
sp|B0JSP4|SYI_MICAN Isoleucine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=ileS PE=3 SV=1 155 889 2.0E-47
sp|B1JKZ8|SYI_YERPY Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ileS PE=3 SV=1 132 887 2.0E-47
sp|Q66ES4|SYI_YERPS Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ileS PE=3 SV=1 132 887 2.0E-47
sp|A4TQF3|SYI_YERPP Isoleucine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=ileS PE=3 SV=1 132 887 2.0E-47
sp|Q1CMV1|SYI_YERPN Isoleucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ileS PE=3 SV=1 132 887 2.0E-47
sp|A9R008|SYI_YERPG Isoleucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ileS PE=3 SV=1 132 887 2.0E-47
sp|Q8ZIM0|SYI_YERPE Isoleucine--tRNA ligase OS=Yersinia pestis GN=ileS PE=3 SV=1 132 887 2.0E-47
sp|B2K3M6|SYI_YERPB Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ileS PE=3 SV=1 132 887 2.0E-47
sp|Q1C0J3|SYI_YERPA Isoleucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ileS PE=3 SV=1 132 887 2.0E-47
sp|B2VGR6|SYI_ERWT9 Isoleucine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ileS PE=3 SV=1 154 889 2.0E-47
sp|Q97ES0|SYI_CLOAB Isoleucine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ileS PE=3 SV=1 132 953 2.0E-47
sp|B4F2T5|SYI_PROMH Isoleucine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=ileS PE=3 SV=1 133 887 3.0E-47
sp|A0KG39|SYI_AERHH Isoleucine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ileS PE=3 SV=1 132 892 3.0E-47
sp|Q8EBI4|SYI_SHEON Isoleucine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=ileS PE=3 SV=1 155 887 3.0E-47
sp|A9KEI8|SYI_COXBN Isoleucine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ileS PE=3 SV=1 155 922 4.0E-47
sp|B6J9J5|SYI_COXB1 Isoleucine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=ileS PE=3 SV=1 155 922 4.0E-47
sp|B8DPD6|SYI_DESVM Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=ileS PE=3 SV=1 151 917 4.0E-47
sp|Q0AAD1|SYI_ALKEH Isoleucine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ileS PE=3 SV=1 137 913 5.0E-47
sp|Q846V6|SYI_STAEP Isoleucine--tRNA ligase OS=Staphylococcus epidermidis GN=ileS PE=3 SV=1 148 888 5.0E-47
sp|A9NBM5|SYI_COXBR Isoleucine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ileS PE=3 SV=1 155 922 5.0E-47
sp|Q5HPZ9|SYI_STAEQ Isoleucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ileS PE=3 SV=1 148 888 5.0E-47
sp|O67411|SYV_AQUAE Valine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=valS PE=3 SV=1 491 554 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0005524 ATP binding Yes
GO:0002161 aminoacyl-tRNA editing activity Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0032553 ribonucleotide binding No
GO:0016874 ligase activity No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016787 hydrolase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0009987 cellular process No
GO:0006520 cellular amino acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0052689 carboxylic ester hydrolase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup934
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5256 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7649
Ophiocordyceps camponoti-floridani Ophcf2|00415
Ophiocordyceps camponoti-rufipedis Ophun1|4245
Ophiocordyceps kimflemingae Ophio5|6335
Ophiocordyceps subramaniannii Hirsu2|6684

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5256
MTPPPVAAATKADVSAETHASAAGLHASGAEAGSGGGSAAAGPAQPPKSEKEVFRERQRAERAARIEAKKAKAAQ
MAANSAKEKKAKDKKEETVPQYVEDTPPGEKKRIRSFQDANFKAYDPVAVESAWYDWWEKEGFFKPEFAAGGKVK
EAGSFVIVHPPPNVTGSLHMGHALGDSLQDVMIRWNRMKGKTTLWLPGCDHAGISTQSVVENMLWRRQQKTRHDL
GRTKFIETVWEWKQEYHERINKALTRMGGSFDWSREAFTMDANLSAAVAETFVQLHDEGIIYRANRLVNWCTKLN
TALSNLEVVNKELTGRTLLDVPGYDKKVEFGVIVHFCYPIQDSDETIQVATTRVETMLGDTGIAVHPEDERYKHL
VGKNAVHPFIPGRKLPIVADDYVDMSFGTGAVKLTPAHDPNDFVLGQRHKLDFVNILTDDGLMNDNAGAFKGQKR
FDVRYAIQDALKDKGLYVDKKDNAMKVPLCEKSKDVIEPIMKPQWWVRMKELAEPAMQAVRDGQIKIKPESAERS
YFRWLQDINDWCISRQLWWGHRCPAYFAKLDEGSGEMPEDKLWFSGRTRQEAEQKAAAALPGKKYTLEQDEDVLD
TWFSSGLWPFSTLGWPNKTHDLDTLYPTSVLETGWDILFFWIARMITLGLKMTGKVPFGEVYCHSLVRDSDGRKM
SKSLGNVIDPLDVISGIKLQDLHDKLQLGNLDPSEVQKATKYQKTAFPDGIPQCGADALRFTMINASTGGGDINL
DVKVIYAYRKFCNKIFQATKYVLGSLPQDFVPSKHRNVRPRTLAERWILHKMNSAARDLNAALEEREFSKSSIII
YRYWYAELCDVYIENSKAIIRDGTPEERESAIQTLYTTLDAALTLIHPFMPFVTEELWQRMPRRPGDDTRSIMLA
QYPQYDEALDDGESEDAYELVLDCVKAARSLMAEYSLKTDAQVFIQAFSKTALETCHSQVASIKSLSGKAVSAIE
VIGSEAPRPAGCVAYPVSTSATVYLYVKGRVDMDAEIAKAQKKLDRARATAERQQRTLDDAGYKEKVSVAVREMD
EQRLADARQEEHSYGETIKQFEQLKVE*
Coding >OphauG2|5256
ATGACGCCGCCCCCCGTTGCCGCGGCCACAAAAGCTGATGTCTCTGCTGAGACCCACGCAAGTGCCGCGGGCCTT
CATGCCTCGGGCGCCGAGGCCGGCTCTGGTGGTGGCTCGGCTGCCGCTGGCCCTGCTCAGCCGCCCAAATCCGAA
AAAGAGGTGTTCAGGGAGCGGCAAAGAGCTGAGCGGGCAGCCAGAATAGAAGCCAAAAAGGCAAAGGCGGCCCAA
ATGGCGGCAAACTCGGCCAAGGAGAAAAAGGCCAAAGACAAAAAGGAAGAGACGGTTCCCCAATACGTCGAGGAC
ACACCACCCGGTGAAAAGAAGCGTATCCGGTCTTTCCAGGACGCAAACTTCAAGGCCTACGACCCAGTTGCTGTC
GAATCAGCTTGGTATGACTGGTGGGAAAAGGAAGGCTTCTTCAAGCCCGAGTTCGCGGCCGGGGGCAAAGTCAAG
GAGGCCGGCAGCTTCGTCATTGTCCACCCACCCCCAAACGTCACTGGGTCTCTGCACATGGGCCATGCCTTGGGC
GATTCGCTTCAGGATGTCATGATTCGGTGGAACAGGATGAAGGGCAAGACGACTTTGTGGCTTCCGGGCTGCGAC
CACGCTGGCATCTCCACCCAGAGCGTTGTCGAGAACATGCTGTGGCGGAGACAGCAAAAGACGCGCCATGACCTT
GGCCGCACCAAATTCATCGAAACGGTCTGGGAATGGAAGCAGGAATACCACGAGCGCATCAACAAGGCGCTGACG
CGCATGGGCGGTTCTTTTGACTGGAGTCGTGAGGCCTTCACCATGGACGCAAACCTCTCGGCAGCCGTGGCGGAG
ACATTTGTCCAGCTTCACGACGAGGGCATCATATACCGGGCCAACCGCCTCGTCAACTGGTGCACCAAGCTCAAC
ACGGCTCTCTCCAACCTTGAAGTCGTAAACAAAGAGCTGACGGGCCGCACCCTCCTGGATGTGCCTGGCTATGAC
AAAAAGGTGGAGTTTGGTGTCATTGTGCATTTTTGCTATCCCATTCAAGACTCAGACGAGACTATCCAAGTGGCG
ACTACCCGTGTCGAGACGATGCTTGGTGACACGGGCATCGCCGTTCACCCCGAGGATGAGCGATACAAGCACTTG
GTTGGCAAGAATGCCGTGCACCCCTTTATCCCCGGCCGCAAGCTGCCCATTGTTGCCGACGACTACGTCGACATG
TCCTTTGGCACTGGCGCAGTCAAGCTGACGCCCGCTCACGACCCCAATGACTTTGTCCTGGGGCAGAGACACAAG
CTCGACTTTGTCAATATCCTGACGGACGACGGCCTGATGAATGACAATGCCGGGGCCTTCAAGGGCCAGAAGCGC
TTTGACGTGCGCTATGCTATCCAAGATGCACTCAAGGACAAGGGCCTCTATGTGGACAAGAAGGACAACGCAATG
AAGGTGCCGCTGTGCGAAAAGTCCAAGGACGTGATTGAGCCCATAATGAAGCCTCAGTGGTGGGTGCGCATGAAG
GAGCTGGCTGAGCCGGCCATGCAGGCGGTCAGAGACGGCCAAATCAAGATCAAGCCCGAAAGCGCCGAGCGCAGC
TATTTCCGCTGGCTACAAGACATCAATGACTGGTGCATCAGCCGGCAGCTCTGGTGGGGCCACCGCTGTCCGGCC
TACTTTGCAAAGCTTGACGAGGGCTCGGGCGAGATGCCCGAGGACAAGCTCTGGTTTTCCGGCCGGACCCGACAA
GAGGCTGAGCAAAAGGCTGCTGCAGCACTGCCGGGCAAGAAGTATACCCTTGAGCAGGACGAAGACGTGCTTGAC
ACCTGGTTCTCGTCGGGTCTTTGGCCCTTTAGCACGCTCGGGTGGCCCAACAAGACTCACGACTTGGACACGCTC
TATCCCACGTCGGTCCTCGAGACGGGGTGGGACATTCTCTTTTTCTGGATCGCCCGCATGATTACTCTTGGCCTG
AAGATGACGGGCAAGGTCCCCTTTGGCGAGGTCTACTGCCACAGCCTTGTCCGCGACTCGGACGGCCGCAAGATG
AGCAAGAGCTTGGGCAATGTCATTGACCCTCTCGACGTCATCTCGGGCATCAAGCTCCAAGACCTGCACGACAAG
CTGCAGCTCGGCAACCTCGACCCAAGCGAGGTCCAAAAGGCAACCAAGTATCAAAAGACGGCTTTCCCCGACGGC
ATTCCTCAGTGCGGAGCAGATGCGCTGCGCTTCACAATGATCAATGCCAGCACGGGTGGCGGAGATATCAACTTG
GACGTCAAGGTCATCTACGCCTACCGCAAGTTTTGCAACAAGATTTTCCAAGCCACCAAATATGTCCTTGGCAGC
CTGCCGCAAGACTTCGTTCCCTCCAAGCACCGCAATGTGCGCCCAAGGACTCTGGCTGAGCGCTGGATCCTCCAC
AAGATGAACAGCGCCGCAAGAGACTTGAATGCGGCACTTGAAGAGCGCGAGTTTTCCAAATCGTCAATCATTATC
TACCGCTACTGGTATGCCGAGTTGTGCGATGTCTATATCGAGAACTCAAAGGCCATTATCCGCGACGGCACGCCA
GAGGAACGCGAGTCGGCCATTCAGACGCTCTACACGACACTCGATGCAGCCTTGACCCTCATACACCCATTCATG
CCCTTTGTCACGGAAGAATTGTGGCAGCGAATGCCTCGAAGGCCTGGTGACGACACCAGGTCCATTATGCTTGCC
CAGTACCCGCAGTATGATGAGGCTCTCGACGATGGCGAGTCCGAGGATGCCTATGAGCTTGTGTTGGATTGTGTC
AAGGCAGCTCGGTCGCTCATGGCCGAATACTCGCTCAAGACGGATGCTCAAGTTTTCATACAGGCCTTTAGCAAG
ACGGCTCTCGAGACTTGCCACAGCCAGGTCGCCTCCATCAAGTCGCTGAGCGGCAAGGCGGTGAGCGCCATCGAG
GTGATTGGGTCCGAGGCTCCTCGGCCCGCCGGTTGCGTGGCATATCCCGTGTCGACAAGCGCCACCGTCTATCTC
TACGTCAAGGGCCGTGTCGACATGGACGCTGAGATTGCCAAGGCGCAAAAGAAGCTTGATCGGGCCAGGGCCACG
GCTGAGCGCCAGCAAAGGACTCTGGACGACGCTGGCTACAAGGAAAAGGTGTCTGTGGCGGTGCGTGAAATGGAC
GAGCAGCGGCTGGCCGACGCCAGACAAGAGGAGCACAGCTATGGGGAGACTATTAAACAGTTTGAGCAGCTCAAG
GTTGAGTGA
Transcript >OphauG2|5256
ATGACGCCGCCCCCCGTTGCCGCGGCCACAAAAGCTGATGTCTCTGCTGAGACCCACGCAAGTGCCGCGGGCCTT
CATGCCTCGGGCGCCGAGGCCGGCTCTGGTGGTGGCTCGGCTGCCGCTGGCCCTGCTCAGCCGCCCAAATCCGAA
AAAGAGGTGTTCAGGGAGCGGCAAAGAGCTGAGCGGGCAGCCAGAATAGAAGCCAAAAAGGCAAAGGCGGCCCAA
ATGGCGGCAAACTCGGCCAAGGAGAAAAAGGCCAAAGACAAAAAGGAAGAGACGGTTCCCCAATACGTCGAGGAC
ACACCACCCGGTGAAAAGAAGCGTATCCGGTCTTTCCAGGACGCAAACTTCAAGGCCTACGACCCAGTTGCTGTC
GAATCAGCTTGGTATGACTGGTGGGAAAAGGAAGGCTTCTTCAAGCCCGAGTTCGCGGCCGGGGGCAAAGTCAAG
GAGGCCGGCAGCTTCGTCATTGTCCACCCACCCCCAAACGTCACTGGGTCTCTGCACATGGGCCATGCCTTGGGC
GATTCGCTTCAGGATGTCATGATTCGGTGGAACAGGATGAAGGGCAAGACGACTTTGTGGCTTCCGGGCTGCGAC
CACGCTGGCATCTCCACCCAGAGCGTTGTCGAGAACATGCTGTGGCGGAGACAGCAAAAGACGCGCCATGACCTT
GGCCGCACCAAATTCATCGAAACGGTCTGGGAATGGAAGCAGGAATACCACGAGCGCATCAACAAGGCGCTGACG
CGCATGGGCGGTTCTTTTGACTGGAGTCGTGAGGCCTTCACCATGGACGCAAACCTCTCGGCAGCCGTGGCGGAG
ACATTTGTCCAGCTTCACGACGAGGGCATCATATACCGGGCCAACCGCCTCGTCAACTGGTGCACCAAGCTCAAC
ACGGCTCTCTCCAACCTTGAAGTCGTAAACAAAGAGCTGACGGGCCGCACCCTCCTGGATGTGCCTGGCTATGAC
AAAAAGGTGGAGTTTGGTGTCATTGTGCATTTTTGCTATCCCATTCAAGACTCAGACGAGACTATCCAAGTGGCG
ACTACCCGTGTCGAGACGATGCTTGGTGACACGGGCATCGCCGTTCACCCCGAGGATGAGCGATACAAGCACTTG
GTTGGCAAGAATGCCGTGCACCCCTTTATCCCCGGCCGCAAGCTGCCCATTGTTGCCGACGACTACGTCGACATG
TCCTTTGGCACTGGCGCAGTCAAGCTGACGCCCGCTCACGACCCCAATGACTTTGTCCTGGGGCAGAGACACAAG
CTCGACTTTGTCAATATCCTGACGGACGACGGCCTGATGAATGACAATGCCGGGGCCTTCAAGGGCCAGAAGCGC
TTTGACGTGCGCTATGCTATCCAAGATGCACTCAAGGACAAGGGCCTCTATGTGGACAAGAAGGACAACGCAATG
AAGGTGCCGCTGTGCGAAAAGTCCAAGGACGTGATTGAGCCCATAATGAAGCCTCAGTGGTGGGTGCGCATGAAG
GAGCTGGCTGAGCCGGCCATGCAGGCGGTCAGAGACGGCCAAATCAAGATCAAGCCCGAAAGCGCCGAGCGCAGC
TATTTCCGCTGGCTACAAGACATCAATGACTGGTGCATCAGCCGGCAGCTCTGGTGGGGCCACCGCTGTCCGGCC
TACTTTGCAAAGCTTGACGAGGGCTCGGGCGAGATGCCCGAGGACAAGCTCTGGTTTTCCGGCCGGACCCGACAA
GAGGCTGAGCAAAAGGCTGCTGCAGCACTGCCGGGCAAGAAGTATACCCTTGAGCAGGACGAAGACGTGCTTGAC
ACCTGGTTCTCGTCGGGTCTTTGGCCCTTTAGCACGCTCGGGTGGCCCAACAAGACTCACGACTTGGACACGCTC
TATCCCACGTCGGTCCTCGAGACGGGGTGGGACATTCTCTTTTTCTGGATCGCCCGCATGATTACTCTTGGCCTG
AAGATGACGGGCAAGGTCCCCTTTGGCGAGGTCTACTGCCACAGCCTTGTCCGCGACTCGGACGGCCGCAAGATG
AGCAAGAGCTTGGGCAATGTCATTGACCCTCTCGACGTCATCTCGGGCATCAAGCTCCAAGACCTGCACGACAAG
CTGCAGCTCGGCAACCTCGACCCAAGCGAGGTCCAAAAGGCAACCAAGTATCAAAAGACGGCTTTCCCCGACGGC
ATTCCTCAGTGCGGAGCAGATGCGCTGCGCTTCACAATGATCAATGCCAGCACGGGTGGCGGAGATATCAACTTG
GACGTCAAGGTCATCTACGCCTACCGCAAGTTTTGCAACAAGATTTTCCAAGCCACCAAATATGTCCTTGGCAGC
CTGCCGCAAGACTTCGTTCCCTCCAAGCACCGCAATGTGCGCCCAAGGACTCTGGCTGAGCGCTGGATCCTCCAC
AAGATGAACAGCGCCGCAAGAGACTTGAATGCGGCACTTGAAGAGCGCGAGTTTTCCAAATCGTCAATCATTATC
TACCGCTACTGGTATGCCGAGTTGTGCGATGTCTATATCGAGAACTCAAAGGCCATTATCCGCGACGGCACGCCA
GAGGAACGCGAGTCGGCCATTCAGACGCTCTACACGACACTCGATGCAGCCTTGACCCTCATACACCCATTCATG
CCCTTTGTCACGGAAGAATTGTGGCAGCGAATGCCTCGAAGGCCTGGTGACGACACCAGGTCCATTATGCTTGCC
CAGTACCCGCAGTATGATGAGGCTCTCGACGATGGCGAGTCCGAGGATGCCTATGAGCTTGTGTTGGATTGTGTC
AAGGCAGCTCGGTCGCTCATGGCCGAATACTCGCTCAAGACGGATGCTCAAGTTTTCATACAGGCCTTTAGCAAG
ACGGCTCTCGAGACTTGCCACAGCCAGGTCGCCTCCATCAAGTCGCTGAGCGGCAAGGCGGTGAGCGCCATCGAG
GTGATTGGGTCCGAGGCTCCTCGGCCCGCCGGTTGCGTGGCATATCCCGTGTCGACAAGCGCCACCGTCTATCTC
TACGTCAAGGGCCGTGTCGACATGGACGCTGAGATTGCCAAGGCGCAAAAGAAGCTTGATCGGGCCAGGGCCACG
GCTGAGCGCCAGCAAAGGACTCTGGACGACGCTGGCTACAAGGAAAAGGTGTCTGTGGCGGTGCGTGAAATGGAC
GAGCAGCGGCTGGCCGACGCCAGACAAGAGGAGCACAGCTATGGGGAGACTATTAAACAGTTTGAGCAGCTCAAG
GTTGAGTGA
Gene >OphauG2|5256
ATGACGCCGCCCCCCGTTGCCGCGGCCACAAAAGCTGATGTCTCTGCTGAGACCCACGCAAGTGCCGCGGGCCTT
CATGCCTCGGGCGCCGAGGCCGGCTCTGGTGGTGGCTCGGCTGCCGCTGGCCCTGCTCAGCCGCCCAAATCCGAA
AAAGAGGGTAAGCTGCTCGTCACTTTCAATGGACCAACAAGATGGCCCGCTAAACATGGCGGCAGTGTTCAGGGA
GCGGCAAAGAGCTGAGCGGGCAGCCAGAATAGAAGCCAAAAAGGCAAAGGCGGCCCAAATGGCGGCAAACTCGGC
CAAGGAGAAAAAGGCCAAAGACAAAAAGGAAGAGACGGTTCCCCAATACGTCGAGGACACACCACCCGGTGAAAA
GAAGCGTATCCGGTCTTTCCAGGACGCAAACTTCAAGGCCTACGACCCAGTTGCTGTCGAATCAGCTTGGTATGA
CTGGTGGGAAAAGGAAGGCTTCTTCAAGCCCGAGTTCGCGGCCGGGGGCAAAGTCAAGGAGGCCGGCAGCTTCGT
CATTGTCCACCCACCCCCAAACGTCACTGGGTCTCTGCACATGGGCCATGCCTTGGGCGATTCGCTTCAGGATGT
CATGATTCGGTGGAACAGGATGAAGGGCAAGACGACTTTGTGGCTTCCGGGCTGCGACCACGCTGGCATCTCCAC
CCAGAGCGTTGTCGAGAACATGCTGTGGCGGAGACAGCAAAAGACGCGCCATGACCTTGGCCGCACCAAATTCAT
CGAAACGGTCTGGGAATGGAAGCAGGAATACCACGAGCGCATCAACAAGGCGCTGACGCGCATGGGCGGTTCTTT
TGACTGGAGTCGTGAGGGTGAGAGCTTTGCTGATGCAACCGCGCCAAATCCTGGTCGGGGCAATGCATGCTGACC
GGCCAAACAGCCTTCACCATGGACGCAAACCTCTCGGCAGCCGTGGCGGAGACATTTGTCCAGCTTCACGACGAG
GGCATCATATACCGGGCCAACCGCCTCGTCAACTGGTGCACCAAGCTCAACACGGCTCTCTCCAACCTTGAAGTC
GTAAACAAAGAGCTGACGGGCCGCACCCTCCTGGATGTGCCTGGCTATGACAAAAAGGTGGAGTTTGGTGTCATT
GTGCATTTTTGCTATCCCATTCAAGACTCAGACGAGACTATCCAAGTGGCGACTACCCGTGTCGAGACGATGCTT
GGTGACACGGGCATCGCCGTTCACCCCGAGGATGAGCGATACAAGCACTTGGTTGGCAAGAATGCCGTGCACCCC
TTTATCCCCGGCCGCAAGCTGCCCATTGTTGCCGACGACTACGTCGACATGTCCTTTGGCACTGGCGCAGTCAAG
CTGACGCCCGCTCACGACCCCAATGACTTTGTCCTGGGGCAGAGACACAAGCTCGACTTTGTCAATATCCTGACG
GACGACGGCCTGATGAATGACAATGCCGGGGCCTTCAAGGGCCAGAAGCGCTTTGACGTGCGCTATGCTATCCAA
GATGCACTCAAGGACAAGGGCCTCTATGTGGACAAGAAGGACAACGCAATGAAGGTGCCGCTGTGCGAAAAGTCC
AAGGACGTGATTGAGCCCATAATGAAGCCTCAGTGGTGGGTGCGCATGAAGGAGCTGGCTGAGCCGGCCATGCAG
GCGGTCAGAGACGGCCAAATCAAGATCAAGCCCGAAAGCGCCGAGCGCAGCTATTTCCGCTGGCTACAAGACATC
AATGACTGGTGCATCAGCCGGCAGCTCTGGTGGGGCCACCGCTGTCCGGCCTACTTTGCAAAGCTTGACGAGGGC
TCGGGCGAGATGCCCGAGGACAAGCTCTGGTTTTCCGGCCGGACCCGACAAGAGGCTGAGCAAAAGGCTGCTGCA
GCACTGCCGGGCAAGAAGTATACCCTTGAGCAGGACGAAGACGTGCTTGACAGTGAGTCGTGGCCACGGCGGCTT
GCAAGGTGATTACCAGAGGCAGACTAACAGTCAACGTGCAGCCTGGTTCTCGTCGGGTCTTTGGCCCTTTAGCAC
GCTCGGGTGGCCCAACAAGACTCACGACTTGGACACGCTCTATCCCACGTCGGTCCTCGAGACGGGGTGGGACAT
TCTCTTTTTCTGGATCGCCCGCATGATTACTCTTGGCCTGAAGATGACGGGCAAGGTCCCCTTTGGCGAGGTCTA
CTGCCACAGCCTTGTCCGCGACTCGGACGGCCGCAAGATGAGCAAGAGCTTGGGCAATGTCATTGACCCTCTCGA
CGTCATCTCGGGCATCAAGCTCCAAGACCTGCACGACAAGCTGCAGCTCGGCAACCTCGACCCAAGCGAGGTCCA
AAAGGCAACCAAGTATCAAAAGACGGCTTTCCCCGACGGCATTCCTCAGTGCGGAGCAGATGCGCTGCGCTTCAC
AATGATCAATGCCAGCACGGGTGGCGGAGATATCAACTTGGACGTCAAGGTGTAGGTGGCTTTGGGCAAAGCCCT
CGAGAACTGGCTAACGAGGCTCTTAGCATCTACGCCTACCGCAAGTTTTGCAACAAGATTGTAAGCCTCGTCGAG
GCGGCCCAGCAAACTACTCTCGGACACCATGTGCTGACGTGTAGCCAGTTCCAAGCCACCAAATATGTCCTTGGC
AGCCTGCCGCAAGACTTCGTTCCCTCCAAGCACCGCAATGTGCGCCCAAGGACTCTGGCTGAGCGCTGGATCCTC
CACAAGATGAACAGCGCCGCAAGAGACTTGAATGCGGCACTTGAAGAGCGCGAGTTTTCCAAATCGTCAATCATT
ATCTACCGCTACTGGTATGCCGAGTTGTGCGATGTCTATATCGAGAACTCAAAGGCCATTATCCGCGACGGCACG
CCAGAGGAACGCGAGTCGGCCATTCAGACGCTCTACACGACACTCGATGCAGCCTTGACCCTCATACACCCATTC
ATGCCCTTTGTCACGGAAGAATTGTGGCAGCGAATGCCTCGAAGGCCTGGTGACGACACCAGGTCCATTATGCTT
GCCCAGTACCCGCAGTATGATGAGGCTCTCGACGATGGCGAGTCCGAGGATGCCTATGAGCTTGTGTTGGATTGT
GTCAAGGCAGCTCGGTCGCTCATGGCCGAATACTCGCTCAAGACGGATGCTCAAGGTTAGTGTGAAGAATGTGAC
GGGCCAGGCTGACATGGAACAAGCAACGCTGACTCCCGAGGCAGTTTTCATACAGGCCTTTAGCAAGACGGCTCT
CGAGACTTGCCACAGCCAGGTCGCCTCCATCAAGTCGCTGAGCGGCAAGGCGGTGAGCGCCATCGAGGTGATTGG
GTCCGAGGCTCCTCGGCCCGCCGGTTGCGTGGCATATCCCGTGTCGACAAGCGCCACCGTCTATCTCTACGTCAA
GGGCCGTGTCGACATGGACGCTGAGATTGCCAAGGCGCAAAAGAAGCTTGATCGGGCCAGGGCCACGGCTGAGCG
CCAGCAAAGGACTCTGGACGACGCTGGCTACAAGGAAAAGGTGTCTGTGGCGGTGCGTGAAATGGACGAGCAGCG
GCTGGCCGACGCCAGACAAGAGGAGCACAGCTATGGGGAGACTATTAAACAGTTTGAGCAGCTCAAGGTTGAGTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail