Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5254
Gene name
LocationContig_475:7497..8152
Strand-
Gene length (bp)655
Transcript length (bp)501
Coding sequence length (bp)501
Protein length (aa) 167

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18126 Mitoc_mL59 Mitochondrial ribosomal protein mL59 5.2E-40 22 154

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P23369|RM25_YEAST 54S ribosomal protein L25, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL25 PE=1 SV=2 11 149 2.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5254
MTPAVLKPPSSYLELAKKLPPPLLRFLARWPPASIHANPDKPILTSYQQQRPDPFRPFKHPATGCWHDAVYSRRK
QADLMRLAQKHGVAELMPVSQKDPERRLAKRVEFGLRVKGTGVGQQVKGHAHERTMIARHEKRRKAMLAMPKLIK
QFKKVGKRRWKKFPKL*
Coding >OphauG2|5254
ATGACGCCCGCCGTGCTGAAACCGCCCTCGTCCTACTTGGAGCTCGCCAAAAAACTCCCCCCGCCCCTGCTGCGC
TTCCTTGCTCGCTGGCCGCCTGCCTCGATTCATGCCAACCCCGACAAGCCCATCCTCACCTCGTACCAGCAGCAA
CGCCCAGATCCTTTTCGCCCCTTCAAGCATCCCGCCACAGGCTGCTGGCATGACGCTGTCTACTCGCGCCGAAAG
CAGGCCGACTTGATGCGCTTGGCCCAAAAGCACGGTGTGGCAGAGCTCATGCCTGTGTCCCAAAAGGACCCCGAG
CGCCGCCTTGCCAAGCGTGTCGAGTTTGGTTTGCGCGTCAAGGGCACCGGTGTTGGCCAACAAGTCAAGGGCCAT
GCTCACGAAAGAACCATGATTGCCAGGCACGAGAAGAGGAGAAAGGCCATGCTGGCCATGCCCAAGCTCATCAAG
CAGTTCAAAAAGGTTGGAAAGAGACGGTGGAAGAAATTCCCCAAATTATAG
Transcript >OphauG2|5254
ATGACGCCCGCCGTGCTGAAACCGCCCTCGTCCTACTTGGAGCTCGCCAAAAAACTCCCCCCGCCCCTGCTGCGC
TTCCTTGCTCGCTGGCCGCCTGCCTCGATTCATGCCAACCCCGACAAGCCCATCCTCACCTCGTACCAGCAGCAA
CGCCCAGATCCTTTTCGCCCCTTCAAGCATCCCGCCACAGGCTGCTGGCATGACGCTGTCTACTCGCGCCGAAAG
CAGGCCGACTTGATGCGCTTGGCCCAAAAGCACGGTGTGGCAGAGCTCATGCCTGTGTCCCAAAAGGACCCCGAG
CGCCGCCTTGCCAAGCGTGTCGAGTTTGGTTTGCGCGTCAAGGGCACCGGTGTTGGCCAACAAGTCAAGGGCCAT
GCTCACGAAAGAACCATGATTGCCAGGCACGAGAAGAGGAGAAAGGCCATGCTGGCCATGCCCAAGCTCATCAAG
CAGTTCAAAAAGGTTGGAAAGAGACGGTGGAAGAAATTCCCCAAATTATAG
Gene >OphauG2|5254
ATGACGCCCGCCGTGCTGAAACCGCCCTCGTCCTACTTGGAGCTCGCCAAAAAACTCCCCCCGCCCCTGCTGCGC
TTCCTTGCTCGCTGGCCGCCTGCCTCGATTCATGCCAACCCCGACAAGCCCATCCTCACCTCGTACCAGCAGCAA
CGCCCAGATCCTTTTCGCCCCTTCAAGCATCCCGCCACAGGCTGCTGGCATGACGCTGTCTACTCGCGCCGAAAG
CAGGCCGACTTGATGCGCTTGGCCCAAAAGCACGGTGTGGCAGAGCTCATGCCTGTGTCCCAAAAGGACCCCGAG
CGCCGCCTTGCCAAGCGTGTCGAGTTTGGTTTGCGCGTCAAGGGCACCGGTGTTGGCCAACAAGTCAAGGGCCAT
GCTCACGAAAGAACCATGATTGCCAGGTCTGTCCATCTCTTGGCCCTCCTTCATGTGCCGTCTTGATGCCTTGGC
CTGACTCTGATTTGTTCCTTGTTCTCGCAGGCACGAGAAGAGGAGAAAGGCCATGCTGGCCATGCCCAAGCTCAT
CAAGCAGTTCAAAAAGGTGAGCCAAGCAAGCTCGCTCCCCCCCGACTCTGCTTGGCTTGCCTCGGCTTATGCTAA
CTTACTTGGATGCCAGGTTGGAAAGAGACGGTGGAAGAAATTCCCCAAATTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail