Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5254
Gene name
LocationContig_475:7497..8152
Strand-
Gene length (bp)655
Transcript length (bp)501
Coding sequence length (bp)501
Protein length (aa) 167

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18126 Mitoc_mL59 Mitochondrial ribosomal protein mL59 5.2E-40 22 154

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P23369|RM25_YEAST 54S ribosomal protein L25, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL25 PE=1 SV=2 11 149 2.0E-13

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5779
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5254 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7651
Ophiocordyceps camponoti-floridani Ophcf2|00416
Ophiocordyceps camponoti-rufipedis Ophun1|7270
Ophiocordyceps kimflemingae Ophio5|6337
Ophiocordyceps subramaniannii Hirsu2|9635

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5254
MTPAVLKPPSSYLELAKKLPPPLLRFLARWPPASIHANPDKPILTSYQQQRPDPFRPFKHPATGCWHDAVYSRRK
QADLMRLAQKHGVAELMPVSQKDPERRLAKRVEFGLRVKGTGVGQQVKGHAHERTMIARHEKRRKAMLAMPKLIK
QFKKVGKRRWKKFPKL*
Coding >OphauG2|5254
ATGACGCCCGCCGTGCTGAAACCGCCCTCGTCCTACTTGGAGCTCGCCAAAAAACTCCCCCCGCCCCTGCTGCGC
TTCCTTGCTCGCTGGCCGCCTGCCTCGATTCATGCCAACCCCGACAAGCCCATCCTCACCTCGTACCAGCAGCAA
CGCCCAGATCCTTTTCGCCCCTTCAAGCATCCCGCCACAGGCTGCTGGCATGACGCTGTCTACTCGCGCCGAAAG
CAGGCCGACTTGATGCGCTTGGCCCAAAAGCACGGTGTGGCAGAGCTCATGCCTGTGTCCCAAAAGGACCCCGAG
CGCCGCCTTGCCAAGCGTGTCGAGTTTGGTTTGCGCGTCAAGGGCACCGGTGTTGGCCAACAAGTCAAGGGCCAT
GCTCACGAAAGAACCATGATTGCCAGGCACGAGAAGAGGAGAAAGGCCATGCTGGCCATGCCCAAGCTCATCAAG
CAGTTCAAAAAGGTTGGAAAGAGACGGTGGAAGAAATTCCCCAAATTATAG
Transcript >OphauG2|5254
ATGACGCCCGCCGTGCTGAAACCGCCCTCGTCCTACTTGGAGCTCGCCAAAAAACTCCCCCCGCCCCTGCTGCGC
TTCCTTGCTCGCTGGCCGCCTGCCTCGATTCATGCCAACCCCGACAAGCCCATCCTCACCTCGTACCAGCAGCAA
CGCCCAGATCCTTTTCGCCCCTTCAAGCATCCCGCCACAGGCTGCTGGCATGACGCTGTCTACTCGCGCCGAAAG
CAGGCCGACTTGATGCGCTTGGCCCAAAAGCACGGTGTGGCAGAGCTCATGCCTGTGTCCCAAAAGGACCCCGAG
CGCCGCCTTGCCAAGCGTGTCGAGTTTGGTTTGCGCGTCAAGGGCACCGGTGTTGGCCAACAAGTCAAGGGCCAT
GCTCACGAAAGAACCATGATTGCCAGGCACGAGAAGAGGAGAAAGGCCATGCTGGCCATGCCCAAGCTCATCAAG
CAGTTCAAAAAGGTTGGAAAGAGACGGTGGAAGAAATTCCCCAAATTATAG
Gene >OphauG2|5254
ATGACGCCCGCCGTGCTGAAACCGCCCTCGTCCTACTTGGAGCTCGCCAAAAAACTCCCCCCGCCCCTGCTGCGC
TTCCTTGCTCGCTGGCCGCCTGCCTCGATTCATGCCAACCCCGACAAGCCCATCCTCACCTCGTACCAGCAGCAA
CGCCCAGATCCTTTTCGCCCCTTCAAGCATCCCGCCACAGGCTGCTGGCATGACGCTGTCTACTCGCGCCGAAAG
CAGGCCGACTTGATGCGCTTGGCCCAAAAGCACGGTGTGGCAGAGCTCATGCCTGTGTCCCAAAAGGACCCCGAG
CGCCGCCTTGCCAAGCGTGTCGAGTTTGGTTTGCGCGTCAAGGGCACCGGTGTTGGCCAACAAGTCAAGGGCCAT
GCTCACGAAAGAACCATGATTGCCAGGTCTGTCCATCTCTTGGCCCTCCTTCATGTGCCGTCTTGATGCCTTGGC
CTGACTCTGATTTGTTCCTTGTTCTCGCAGGCACGAGAAGAGGAGAAAGGCCATGCTGGCCATGCCCAAGCTCAT
CAAGCAGTTCAAAAAGGTGAGCCAAGCAAGCTCGCTCCCCCCCGACTCTGCTTGGCTTGCCTCGGCTTATGCTAA
CTTACTTGGATGCCAGGTTGGAAAGAGACGGTGGAAGAAATTCCCCAAATTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail