Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5250
Gene name
LocationContig_474:13951..14619
Strand-
Gene length (bp)668
Transcript length (bp)318
Coding sequence length (bp)318
Protein length (aa) 106

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00571 CBS CBS domain 4.2E-06 60 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10343|AAKG_SCHPO 5'-AMP-activated protein kinase subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbs2 PE=1 SV=2 1 103 1.0E-30
sp|P12904|AAKG_YEAST 5'-AMP-activated protein kinase subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF4 PE=1 SV=1 1 103 8.0E-24
sp|Q9P869|SNF4_KLULA Nuclear protein SNF4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SNF4 PE=3 SV=2 1 103 1.0E-22
sp|Q5R4S0|AAKG2_PONAB 5'-AMP-activated protein kinase subunit gamma-2 OS=Pongo abelii GN=PRKAG2 PE=2 SV=1 1 103 2.0E-13
sp|Q91WG5|AAKG2_MOUSE 5'-AMP-activated protein kinase subunit gamma-2 OS=Mus musculus GN=Prkag2 PE=1 SV=2 1 103 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10343|AAKG_SCHPO 5'-AMP-activated protein kinase subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbs2 PE=1 SV=2 1 103 1.0E-30
sp|P12904|AAKG_YEAST 5'-AMP-activated protein kinase subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF4 PE=1 SV=1 1 103 8.0E-24
sp|Q9P869|SNF4_KLULA Nuclear protein SNF4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SNF4 PE=3 SV=2 1 103 1.0E-22
sp|Q5R4S0|AAKG2_PONAB 5'-AMP-activated protein kinase subunit gamma-2 OS=Pongo abelii GN=PRKAG2 PE=2 SV=1 1 103 2.0E-13
sp|Q91WG5|AAKG2_MOUSE 5'-AMP-activated protein kinase subunit gamma-2 OS=Mus musculus GN=Prkag2 PE=1 SV=2 1 103 2.0E-13
sp|Q9UGJ0|AAKG2_HUMAN 5'-AMP-activated protein kinase subunit gamma-2 OS=Homo sapiens GN=PRKAG2 PE=1 SV=1 1 103 2.0E-13
sp|Q2LL38|AAKG3_BOVIN 5'-AMP-activated protein kinase subunit gamma-3 OS=Bos taurus GN=PRKAG3 PE=2 SV=2 1 103 5.0E-10
sp|Q8BGM7|AAKG3_MOUSE 5'-AMP-activated protein kinase subunit gamma-3 OS=Mus musculus GN=Prkag3 PE=1 SV=1 1 103 7.0E-10
sp|Q9UGI9|AAKG3_HUMAN 5'-AMP-activated protein kinase subunit gamma-3 OS=Homo sapiens GN=PRKAG3 PE=1 SV=3 1 103 3.0E-09
sp|Q9MYP4|AAKG3_PIG 5'-AMP-activated protein kinase subunit gamma-3 OS=Sus scrofa GN=PRKAG3 PE=1 SV=2 1 103 3.0E-09
sp|Q09138|AAKG1_PIG 5'-AMP-activated protein kinase subunit gamma-1 OS=Sus scrofa GN=PRKAG1 PE=1 SV=2 1 103 4.0E-09
sp|O54950|AAKG1_MOUSE 5'-AMP-activated protein kinase subunit gamma-1 OS=Mus musculus GN=Prkag1 PE=1 SV=2 1 103 2.0E-08
sp|P80385|AAKG1_RAT 5'-AMP-activated protein kinase subunit gamma-1 OS=Rattus norvegicus GN=Prkag1 PE=1 SV=3 1 103 2.0E-08
sp|P58108|AAKG1_BOVIN 5'-AMP-activated protein kinase subunit gamma-1 OS=Bos taurus GN=PRKAG1 PE=2 SV=2 1 103 3.0E-08
sp|P54619|AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens GN=PRKAG1 PE=1 SV=1 1 103 3.0E-08
sp|Q8T277|PRKAG_DICDI 5'-AMP-activated protein kinase subunit gamma OS=Dictyostelium discoideum GN=prkag PE=3 SV=3 1 103 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5250
MLKTRARRIPLVDIDDETGRETVISVITQYRILKFIAVNNEHNTVLLKKSVRDIGLGTYHNLATAHMHSSVLDAI
HLMVERNISCIPVIDDAGRLLNAFEAVDNR*
Coding >OphauG2|5250
ATGCTCAAGACTCGTGCCCGTCGCATCCCCCTCGTCGACATTGACGACGAAACTGGCCGCGAAACCGTCATCTCC
GTCATCACCCAGTATCGCATCCTCAAATTCATCGCCGTCAACAATGAACACAACACCGTCCTGCTTAAAAAATCC
GTCCGCGACATTGGCCTCGGCACCTACCACAACCTCGCCACTGCCCACATGCACTCGTCCGTCCTCGACGCCATC
CACCTCATGGTTGAGCGCAACATTAGCTGCATCCCCGTCATTGACGACGCCGGCCGCCTGCTCAACGCCTTCGAG
GCCGTAGACAATAGGTAG
Transcript >OphauG2|5250
ATGCTCAAGACTCGTGCCCGTCGCATCCCCCTCGTCGACATTGACGACGAAACTGGCCGCGAAACCGTCATCTCC
GTCATCACCCAGTATCGCATCCTCAAATTCATCGCCGTCAACAATGAACACAACACCGTCCTGCTTAAAAAATCC
GTCCGCGACATTGGCCTCGGCACCTACCACAACCTCGCCACTGCCCACATGCACTCGTCCGTCCTCGACGCCATC
CACCTCATGGTTGAGCGCAACATTAGCTGCATCCCCGTCATTGACGACGCCGGCCGCCTGCTCAACGCCTTCGAG
GCCGTAGACAATAGGTAG
Gene >OphauG2|5250
ATGCTCAAGACTCGTGCCCGTCGCATCCCCCTCGTCGACATTGACGACGAAACTGGCCGCGAAACCGTCATCTCC
GTCATCACCCAGTATCGCATCCTCAAATTCATCGCCGTCAACAATGAACACAACACCGTCCTGCTTAAAAAATCC
GTCCGCGACATTGGCCTCGGCACCTACCACAACCTCGCCACTGCCCACATGCACTCGTCCGTCCTCGACGCCATC
CACCTCATGGTTGAGCGCAACATTAGCTGCATCCCCGTCATTGACGACGCCGGCCGCCTGCTCAACGCCTTCGAG
GCCGTAGACGTTATTCCCGTCATCAAGGGCGGCGCATACGAAGACCTCGACGNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNTTTTTTTTTTTTGGAGTTGAAAGCTTGAGTCTTGATATATATGTCGTTAGAATAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail