Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5248
Gene name
LocationContig_474:7544..8909
Strand-
Gene length (bp)1365
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03583 LIP Secretory lipase 3.5E-11 172 429
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.2E-08 172 408
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.6E-06 145 382

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0004806 triglyceride lipase activity Yes
GO:0016042 lipid catabolic process Yes
GO:0003674 molecular_function No
GO:0016298 lipase activity No
GO:0009056 catabolic process No
GO:0006629 lipid metabolic process No
GO:1901575 organic substance catabolic process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0052689 carboxylic ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5248
MVFLFSLLALPLLARLGLAGQAADFNLSKAEFEKHNCDDSCQSIIASQIQRDVGVVGIDFDYDFYATPSNLSDSE
PGDVLKFKVMNATARQYKTGTTVYLFMYTTIDLDGKKVPSSGFIAFPYEAGLMSDPNSKSSCRVFPLVAFAHGTS
GVWPGCAPSNGLVLGHLDTWQPLIARGYAVVATDYAGLGNNYTTHKYLSMQAQATDTYYSVVAARKLFGNVLSRE
WVSAGHSQGGGAVWKLAESDYVRNDTNYLGTVAMAPATFIAESLEASRNNPGSAGYLPLATIAISRVFPDYKAMV
LTPEFTNRAALATEGQYCVYPMLSLAQGLPYDQLVSKQGAQRDAQYLQKWQDQQAPAQGARSPAPILVIQGLNDT
TVAPVVTKNAFQMSCKAGNLIHMSLYPGMEHEPVLPAAEPEWLTWIDWRFQGGQYSHGGCVEVTRMPFDPKDMKT
NQGQ*
Coding >OphauG2|5248
ATGGTTTTTTTGTTTAGCTTGCTCGCTCTCCCGCTGCTGGCTCGGCTCGGCCTGGCTGGACAGGCGGCCGACTTT
AATCTTTCAAAGGCGGAATTCGAAAAGCACAACTGCGATGACTCGTGCCAATCCATAATTGCAAGCCAAATACAG
AGAGATGTGGGCGTGGTTGGCATCGACTTTGACTATGACTTTTACGCAACGCCGAGCAATTTAAGCGACAGCGAG
CCGGGCGATGTGCTCAAGTTCAAGGTGATGAACGCAACGGCGCGGCAATACAAGACCGGGACAACCGTCTACCTC
TTCATGTACACGACGATTGATCTCGACGGCAAAAAGGTGCCGTCGTCGGGCTTCATCGCGTTCCCGTACGAGGCG
GGCCTGATGAGTGATCCCAACAGCAAAAGCAGCTGCAGGGTGTTTCCCCTGGTGGCGTTTGCGCACGGGACATCG
GGTGTCTGGCCGGGATGCGCGCCGAGCAATGGCTTGGTCCTGGGACACCTCGACACTTGGCAGCCGCTGATTGCG
CGCGGGTACGCCGTCGTGGCCACCGACTATGCAGGCTTGGGAAACAACTACACGACGCACAAGTACCTGAGCATG
CAGGCGCAGGCGACGGACACGTACTACTCCGTCGTGGCGGCGCGGAAGCTGTTTGGAAATGTGCTGTCGCGCGAG
TGGGTGAGCGCAGGCCATTCGCAGGGCGGCGGAGCGGTGTGGAAGCTGGCCGAGAGCGACTATGTGCGCAACGAC
ACCAACTATCTCGGCACTGTGGCCATGGCGCCGGCAACATTTATAGCCGAGTCTCTCGAGGCGAGTAGAAACAAT
CCCGGTTCGGCGGGTTATTTGCCGCTGGCCACGATTGCAATCTCGCGGGTTTTTCCGGATTATAAGGCCATGGTC
CTAACTCCCGAATTCACCAACCGAGCAGCCTTGGCTACCGAGGGCCAGTACTGCGTCTACCCCATGCTGTCTCTG
GCCCAGGGGCTGCCATACGACCAACTCGTGAGCAAGCAGGGTGCCCAACGCGACGCTCAATATCTCCAGAAATGG
CAGGACCAGCAAGCCCCGGCTCAGGGAGCACGCTCGCCCGCGCCCATTCTCGTCATCCAGGGGCTCAACGACACC
ACGGTCGCGCCAGTCGTGACCAAGAATGCCTTCCAGATGAGCTGCAAGGCTGGGAACCTTATCCACATGAGTCTA
TACCCTGGCATGGAGCACGAGCCCGTGTTGCCGGCGGCTGAGCCCGAGTGGCTGACGTGGATTGATTGGCGCTTC
CAGGGAGGACAGTATTCCCATGGCGGCTGTGTTGAAGTTACCAGGATGCCGTTTGATCCCAAGGATATGAAGACG
AACCAAGGCCAGTAG
Transcript >OphauG2|5248
ATGGTTTTTTTGTTTAGCTTGCTCGCTCTCCCGCTGCTGGCTCGGCTCGGCCTGGCTGGACAGGCGGCCGACTTT
AATCTTTCAAAGGCGGAATTCGAAAAGCACAACTGCGATGACTCGTGCCAATCCATAATTGCAAGCCAAATACAG
AGAGATGTGGGCGTGGTTGGCATCGACTTTGACTATGACTTTTACGCAACGCCGAGCAATTTAAGCGACAGCGAG
CCGGGCGATGTGCTCAAGTTCAAGGTGATGAACGCAACGGCGCGGCAATACAAGACCGGGACAACCGTCTACCTC
TTCATGTACACGACGATTGATCTCGACGGCAAAAAGGTGCCGTCGTCGGGCTTCATCGCGTTCCCGTACGAGGCG
GGCCTGATGAGTGATCCCAACAGCAAAAGCAGCTGCAGGGTGTTTCCCCTGGTGGCGTTTGCGCACGGGACATCG
GGTGTCTGGCCGGGATGCGCGCCGAGCAATGGCTTGGTCCTGGGACACCTCGACACTTGGCAGCCGCTGATTGCG
CGCGGGTACGCCGTCGTGGCCACCGACTATGCAGGCTTGGGAAACAACTACACGACGCACAAGTACCTGAGCATG
CAGGCGCAGGCGACGGACACGTACTACTCCGTCGTGGCGGCGCGGAAGCTGTTTGGAAATGTGCTGTCGCGCGAG
TGGGTGAGCGCAGGCCATTCGCAGGGCGGCGGAGCGGTGTGGAAGCTGGCCGAGAGCGACTATGTGCGCAACGAC
ACCAACTATCTCGGCACTGTGGCCATGGCGCCGGCAACATTTATAGCCGAGTCTCTCGAGGCGAGTAGAAACAAT
CCCGGTTCGGCGGGTTATTTGCCGCTGGCCACGATTGCAATCTCGCGGGTTTTTCCGGATTATAAGGCCATGGTC
CTAACTCCCGAATTCACCAACCGAGCAGCCTTGGCTACCGAGGGCCAGTACTGCGTCTACCCCATGCTGTCTCTG
GCCCAGGGGCTGCCATACGACCAACTCGTGAGCAAGCAGGGTGCCCAACGCGACGCTCAATATCTCCAGAAATGG
CAGGACCAGCAAGCCCCGGCTCAGGGAGCACGCTCGCCCGCGCCCATTCTCGTCATCCAGGGGCTCAACGACACC
ACGGTCGCGCCAGTCGTGACCAAGAATGCCTTCCAGATGAGCTGCAAGGCTGGGAACCTTATCCACATGAGTCTA
TACCCTGGCATGGAGCACGAGCCCGTGTTGCCGGCGGCTGAGCCCGAGTGGCTGACGTGGATTGATTGGCGCTTC
CAGGGAGGACAGTATTCCCATGGCGGCTGTGTTGAAGTTACCAGGATGCCGTTTGATCCCAAGGATATGAAGACG
AACCAAGGCCAGTAG
Gene >OphauG2|5248
ATGGTTTTTTTGTTTAGCTTGCTCGCTCTCCCGCTGCTGGCTCGGCTCGGCCTGGCTGGACAGGCGGCCGACTTT
AATCTTTCAAAGGCGGAATTCGAAAAGCACAACTGCGATGACTCGTGCCAATCCATAATTGCAAGCCAAATACAG
AGAGATGTGGGCGTGGTTGGCATCGACTTTGACTATGACTTTTACGCAACGCCGAGCAATTTAAGCGACAGCGAG
CCGGGCGATGTGCTCAAGTTCAAGGTGATGAACGCAACGGCGCGGCAATACAAGACCGGGACAACCGTCTACCTC
TTCATGTACACGACGATTGATCTCGACGGCAAAAAGGTGCCGTCGTCGGGCTTCATCGCGTTCCCGTACGAGGCG
GGCCTGATGAGTGATCCCAACAGCAAAAGCAGCTGCAGGGTGTTTCCCCTGGTGGCGTTTGCGCACGGGACATCG
GGTGTCTGGCCGGGATGCGCGCCGAGCAATGGCTTGGTCCTGGGACACCTCGACACTTGGCAGCCGCTGATTGCG
CGCGGGTACGCCGTCGTGGCCACCGACTATGCAGGCTTGGGAAACAACTACACGACGCACAAGTACCTGAGCATG
CAGGCGCAGGCGACGGACACGTACTACTCCGTCGTGGCGGCGCGGAAGCTGTTTGGAAATGTGCTGTCGCGCGAG
TGGGTGAGCGCAGGCCATTCGCAGGGCGGCGGAGCGGTGTGGAAGCTGGCCGAGAGCGACTATGTGCGCAACGAC
ACCAACTATCTCGGCACTGTGGCCATGGCGCCGGCAACATTTATAGCCGAGTCTCTCGAGGCGAGTAGAAACAAT
CCCGGTTCGGCGGGTTATTTGCCGCTGGCCACGATTGCAATCTCGCGGGTTTTTCCGGATTATAAGGCCATGGTC
CTAACTCCCGAATTCACCAACCGAGCAGCCTTGGCTACCGAGGGCCAGTACTGCGTCTACCCCATGCTGTCTCTG
GCCCAGGGGCTGCCATACGACCAACTCGTGAGCAAGCAGGGTGCCCAACGCGACGCTCAATATCTCCAGAAATGG
CAGGACCAGCAAGCCCCGGCTCAGGGAGCACGCTCGCCCGCGCCCATTCTCGTCATCCAGGGGCTCAACGACACC
ACGGTCGCGCCAGTCGTGACCAAGAATGCCTTCCAGATGAGCTGCAAGGCTGGGAACCTTATCCACATGAGTCTA
TACCCTGGCATGGAGCACGAGCCCGTGTTGCCGGCGGCTGAGCCCGAGTGGCTGACGTGGATTGATTGGCGCTTC
CAGGGAGGACAGTATTCCCATGGCGGCTGTGTTGAAGTTACCAGGATGCCGTTTGATCCCAAGGATATGAAGACG
AACCAAGGCCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail