Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5230
Gene name
LocationContig_471:11601..13310
Strand-
Gene length (bp)1709
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 1.4E-14 406 470

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59RL7|CPH2_CANAL Transcription factor CPH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPH2 PE=1 SV=1 399 488 6.0E-18
sp|Q9UUD1|SREBP_SCHPO Sterol regulatory element-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre1 PE=1 SV=1 406 491 5.0E-16
sp|O43019|SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre2 PE=1 SV=1 404 494 1.0E-14
sp|Q5AL36|TYE7_CANAL Carbohydrate metabolism regulator TYE7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TYE7 PE=1 SV=1 385 487 9.0E-09
sp|Q12398|HMS1_YEAST Probable transcription factor HMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMS1 PE=1 SV=1 399 472 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59RL7|CPH2_CANAL Transcription factor CPH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPH2 PE=1 SV=1 399 488 6.0E-18
sp|Q9UUD1|SREBP_SCHPO Sterol regulatory element-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre1 PE=1 SV=1 406 491 5.0E-16
sp|O43019|SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre2 PE=1 SV=1 404 494 1.0E-14
sp|Q5AL36|TYE7_CANAL Carbohydrate metabolism regulator TYE7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TYE7 PE=1 SV=1 385 487 9.0E-09
sp|Q12398|HMS1_YEAST Probable transcription factor HMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMS1 PE=1 SV=1 399 472 1.0E-07
sp|Q07016|MAX_XENLA Protein max OS=Xenopus laevis GN=max PE=2 SV=1 401 485 2.0E-07
sp|O97676|SRBP1_PIG Sterol regulatory element-binding protein 1 OS=Sus scrofa GN=SREBF1 PE=2 SV=2 381 483 2.0E-07
sp|Q60416|SRBP1_CRIGR Sterol regulatory element-binding protein 1 OS=Cricetulus griseus GN=SREBF1 PE=2 SV=1 343 483 2.0E-07
sp|P52162|MAX_CHICK Protein max OS=Gallus gallus GN=MAX PE=3 SV=1 393 485 3.0E-07
sp|P61244|MAX_HUMAN Protein max OS=Homo sapiens GN=MAX PE=1 SV=1 393 485 4.0E-07
sp|P61245|MAX_FELCA Protein max OS=Felis catus GN=MAX PE=2 SV=1 393 485 4.0E-07
sp|P28574|MAX_MOUSE Protein max OS=Mus musculus GN=Max PE=1 SV=1 406 485 4.0E-07
sp|P52164|MAX_RAT Protein max OS=Rattus norvegicus GN=Max PE=1 SV=1 393 485 4.0E-07
sp|P56720|SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus GN=Srebf1 PE=1 SV=3 343 498 5.0E-07
sp|P52161|MAX_DANRE Protein max OS=Danio rerio GN=max PE=2 SV=1 406 485 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5230
MDDDAAMQPAVAMQPSPSIVSPDSFQQPVADMSTTPASSSRMSTTFDFTSAPSDESMPSFDPAIAAFADMSFAST
SMPSPFTQIPPPPAPPPAQSDCFQQQRNLHDKKRIKVDPETSALDTMNYWFDDEDFQGSYEIDFSKHNDPTRVAT
SMPGLGSGLYSTAMAPFREEDFIDDTPWDQALSDDEDMFDMAAQASQCPPETKTQAPAVVAPSAAPLPPRPPTSA
PALRTGFEAPAPAPAPAPAPAPAPVPAPISASGAGSFWGPGRAPLGPRPVRRDIWDNLPRGSHQVLSAEEQRHLL
EVALNLGPSSGQLPGTFMPPTGFGVGFGAGAGLSMRPARHAHGSGMASASIKSQVPRVSPPVAVPGRTDESLRAQ
KTQLARRPVPMRAGLSRKLSTAETKPRSADRVAHNDVERKYRTNLKVKIAELRDAVPSLQSPSGQDGETDMHSGA
PKVSKGTVLTKATEYIQHLEQRNNAIMQEHQQLTRRLQAFETLFNSTGRPELMMPNHSMTLFDPRGFC*
Coding >OphauG2|5230
ATGGACGACGATGCCGCCATGCAGCCAGCCGTCGCGATGCAACCGTCGCCGTCAATCGTCTCGCCCGACTCTTTC
CAGCAGCCTGTCGCCGACATGTCGACAACGCCCGCTTCGAGCTCGAGGATGAGCACTACCTTTGACTTCACCTCG
GCTCCTTCGGACGAGTCGATGCCCTCCTTCGATCCGGCCATTGCCGCCTTTGCAGACATGTCGTTTGCAAGCACG
TCGATGCCATCGCCATTTACACAGATACCACCACCCCCCGCGCCGCCCCCTGCACAGTCTGACTGCTTTCAGCAG
CAGCGCAATCTGCACGACAAGAAGCGCATCAAAGTCGATCCCGAGACGTCCGCCCTCGACACCATGAATTACTGG
TTTGATGACGAGGATTTTCAGGGCAGCTATGAAATCGACTTTTCCAAGCACAACGACCCAACCCGCGTTGCCACT
TCCATGCCCGGATTGGGAAGCGGCCTCTATTCAACTGCAATGGCCCCTTTCCGGGAAGAAGACTTCATTGACGAC
ACGCCATGGGACCAAGCTCTTTCCGACGATGAGGACATGTTCGACATGGCGGCTCAGGCTAGTCAATGTCCGCCC
GAGACCAAAACACAAGCTCCTGCTGTGGTCGCGCCATCAGCTGCACCTCTACCACCTCGGCCACCAACATCGGCT
CCTGCGCTCCGGACCGGCTTTGAAGCTCCAGCACCCGCTCCAGCACCCGCTCCGGCACCCGCTCCAGCACCCGTT
CCGGCACCGATATCTGCCTCGGGAGCAGGGTCCTTTTGGGGCCCCGGTCGGGCTCCTCTGGGTCCTCGACCTGTG
CGTCGTGACATCTGGGACAATCTGCCCCGAGGCTCGCACCAGGTCCTCAGCGCCGAAGAGCAGCGCCATCTGCTC
GAGGTTGCGCTTAACCTTGGCCCTAGCTCGGGTCAGTTGCCTGGGACCTTTATGCCACCCACTGGATTTGGTGTG
GGATTTGGCGCCGGCGCCGGCCTGAGCATGCGCCCAGCAAGACATGCCCACGGGTCCGGTATGGCATCAGCGAGC
ATCAAGTCGCAAGTGCCCCGCGTCTCTCCGCCCGTAGCCGTGCCTGGCAGGACCGACGAAAGTCTGCGGGCCCAA
AAGACGCAGTTGGCGAGGCGGCCTGTCCCGATGCGGGCAGGGCTGTCAAGAAAACTGTCTACAGCTGAGACAAAG
CCGCGATCGGCCGATCGAGTGGCGCACAACGACGTAGAACGCAAATACCGGACAAACCTCAAGGTCAAGATTGCA
GAACTGCGCGACGCAGTACCGTCGCTGCAATCGCCCTCGGGGCAAGACGGAGAGACGGACATGCACTCGGGAGCC
CCCAAAGTCAGCAAGGGGACCGTTTTGACCAAGGCAACCGAGTACATACAGCATCTGGAACAACGCAACAATGCT
ATTATGCAGGAACACCAGCAGCTGACGCGACGACTGCAGGCATTCGAGACGCTCTTCAACAGCACAGGCCGGCCA
GAGCTCATGATGCCCAATCACAGCATGACGCTATTTGACCCCAGAGGCTTCTGCTGA
Transcript >OphauG2|5230
ATGGACGACGATGCCGCCATGCAGCCAGCCGTCGCGATGCAACCGTCGCCGTCAATCGTCTCGCCCGACTCTTTC
CAGCAGCCTGTCGCCGACATGTCGACAACGCCCGCTTCGAGCTCGAGGATGAGCACTACCTTTGACTTCACCTCG
GCTCCTTCGGACGAGTCGATGCCCTCCTTCGATCCGGCCATTGCCGCCTTTGCAGACATGTCGTTTGCAAGCACG
TCGATGCCATCGCCATTTACACAGATACCACCACCCCCCGCGCCGCCCCCTGCACAGTCTGACTGCTTTCAGCAG
CAGCGCAATCTGCACGACAAGAAGCGCATCAAAGTCGATCCCGAGACGTCCGCCCTCGACACCATGAATTACTGG
TTTGATGACGAGGATTTTCAGGGCAGCTATGAAATCGACTTTTCCAAGCACAACGACCCAACCCGCGTTGCCACT
TCCATGCCCGGATTGGGAAGCGGCCTCTATTCAACTGCAATGGCCCCTTTCCGGGAAGAAGACTTCATTGACGAC
ACGCCATGGGACCAAGCTCTTTCCGACGATGAGGACATGTTCGACATGGCGGCTCAGGCTAGTCAATGTCCGCCC
GAGACCAAAACACAAGCTCCTGCTGTGGTCGCGCCATCAGCTGCACCTCTACCACCTCGGCCACCAACATCGGCT
CCTGCGCTCCGGACCGGCTTTGAAGCTCCAGCACCCGCTCCAGCACCCGCTCCGGCACCCGCTCCAGCACCCGTT
CCGGCACCGATATCTGCCTCGGGAGCAGGGTCCTTTTGGGGCCCCGGTCGGGCTCCTCTGGGTCCTCGACCTGTG
CGTCGTGACATCTGGGACAATCTGCCCCGAGGCTCGCACCAGGTCCTCAGCGCCGAAGAGCAGCGCCATCTGCTC
GAGGTTGCGCTTAACCTTGGCCCTAGCTCGGGTCAGTTGCCTGGGACCTTTATGCCACCCACTGGATTTGGTGTG
GGATTTGGCGCCGGCGCCGGCCTGAGCATGCGCCCAGCAAGACATGCCCACGGGTCCGGTATGGCATCAGCGAGC
ATCAAGTCGCAAGTGCCCCGCGTCTCTCCGCCCGTAGCCGTGCCTGGCAGGACCGACGAAAGTCTGCGGGCCCAA
AAGACGCAGTTGGCGAGGCGGCCTGTCCCGATGCGGGCAGGGCTGTCAAGAAAACTGTCTACAGCTGAGACAAAG
CCGCGATCGGCCGATCGAGTGGCGCACAACGACGTAGAACGCAAATACCGGACAAACCTCAAGGTCAAGATTGCA
GAACTGCGCGACGCAGTACCGTCGCTGCAATCGCCCTCGGGGCAAGACGGAGAGACGGACATGCACTCGGGAGCC
CCCAAAGTCAGCAAGGGGACCGTTTTGACCAAGGCAACCGAGTACATACAGCATCTGGAACAACGCAACAATGCT
ATTATGCAGGAACACCAGCAGCTGACGCGACGACTGCAGGCATTCGAGACGCTCTTCAACAGCACAGGCCGGCCA
GAGCTCATGATGCCCAATCACAGCATGACGCTATTTGACCCCAGAGGCTTCTGCTGA
Gene >OphauG2|5230
ATGGACGACGATGCCGCCATGCAGCCAGCCGTCGCGATGCAACCGTCGCCGTCAATCGTCTCGCCCGACTCTTTC
CAGCAGCCTGTCGCCGACATGTCGACAACGCCCGCTTCGAGCTCGAGGATGAGCACTACCTTTGACTTCACCTCG
GCTCCTTCGGACGAGTCGATGCCCTCCTTCGATCCGGCCATTGCCGCCTTTGCAGACATGTCGTTTGCAAGCACG
TCGATGCCATCGCCATTTACACAGATACCACCACCCCCCGCGCCGCCCCCTGCACAGTCTGACTGCTTTCAGCAG
CAGCGCAATCTGCACGACAAGAAGCGCATCAAAGTCGATCCCGAGACGTCCGCCCTCGACACCATGAATTACTGG
TTTGATGACGAGGATTTTCAGGGCAGCTATGAAATCGACTTTTCCAAGCACAACGACCCAACCCGGTAAGCACCT
CACCCAAAGGAGGAAAAACAAAAAGACAAAAGAATTGCCCCCGTTGACTTTGTTGATTGGAGCAGCGTTGCCACT
TCCATGCCCGGATTGGGAAGCGGCCTCTATTCAACTGCAATGGCCCCTTTCCGGGAAGAAGACTTCATTGACGAC
ACGCCATGGGACCAAGCTCTTTCCGACGATGAGGACATGTTCGACATGGCGGCTCAGGCTAGTCAATGTCCGCCC
GAGACCAAAACACAAGCTCCTGCTGTGGTCGCGCCATCAGCTGCACCTCTACCACCTCGGCCACCAACATCGGCT
CCTGCGCTCCGGACCGGCTTTGAAGCTCCAGCACCCGCTCCAGCACCCGCTCCGGCACCCGCTCCAGCACCCGTT
CCGGCACCGATATCTGCCTCGGGAGCAGGGTCCTTTTGGGGCCCCGGTCGGGCTCCTCTGGGTCCTCGACCTGTG
CGTCGTGACATCTGGGACAATCTGCCCCGAGGCTCGCACCAGGTCCTCAGCGCCGAAGAGCAGCGCCATCTGCTC
GAGGTTGCGCTTAACCTTGGCCCTAGCTCGGGTCAGTTGCCTGGGACCTTTATGCCACCCACTGGATTTGGTGTG
GGATTTGGCGCCGGCGCCGGCCTGAGCATGCGCCCAGCAAGACATGCCCACGGGTCCGGTATGGCATCAGCGAGC
ATCAAGTCGCAAGTGCCCCGCGTCTCTCCGCCCGTAGCCGTGCCTGGCAGGACCGACGAAAGTCTGCGGGCCCAA
AAGACGCAGTTGGCGAGGCGGCCTGTCCCGATGCGGGCAGGGCTGTCAAGAAAACTGTCTACAGCTGAGACAAAG
CCGCGATCGGCCGATCGAGTGGCGCACAACGACGTAGAACGCAAATACCGGACAAACCTCAAGGTCAAGATTGCA
GAACTGCGCGACGCAGTACCGTCGCTGCAATCGCCCTCGGGGCAAGACGGAGAGACGGACATGCACTCGGGAGCC
CCCAAAGTCAGCAAGGTAAGGACAAGACCAACCCGTGTTTTGCAAATCAATCCACCATGCCTTGTGGCTAATGCG
AGACAATGAATCAACAGGGGACCGTTTTGACCAAGGCAACCGAGTACATACAGCATCTGGAACAACGCAACAATG
CTATTATGCAGGAACACCAGCAGCTGACGCGACGACTGCAGGCATTCGAGACGCTCTTCAACAGCACAGGCCGGC
CAGAGCTCATGATGCCCAATCACAGCATGACGCTATTTGACCCCAGAGGCTTCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail