Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5228
Gene name
LocationContig_471:6566..8765
Strand-
Gene length (bp)2199
Transcript length (bp)2052
Coding sequence length (bp)2052
Protein length (aa) 684

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08630 Dfp1_Him1_M Dfp1/Him1, central region 7.0E-40 257 388
PF07535 zf-DBF DBF zinc finger 4.7E-21 621 663

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59836|HIM1_SCHPO Hsk1-interacting molecule 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=him1 PE=1 SV=1 257 393 2.0E-17
sp|P32325|DBF4_YEAST DDK kinase regulatory subunit DBF4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF4 PE=1 SV=2 254 387 3.0E-13
sp|O59836|HIM1_SCHPO Hsk1-interacting molecule 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=him1 PE=1 SV=1 615 666 1.0E-12
sp|Q9Y7J1|SPO6_SCHPO Sporulation-specific protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo6 PE=3 SV=1 256 401 2.0E-10
sp|Q9Y7J1|SPO6_SCHPO Sporulation-specific protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo6 PE=3 SV=1 615 666 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59836|HIM1_SCHPO Hsk1-interacting molecule 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=him1 PE=1 SV=1 257 393 2.0E-17
sp|P32325|DBF4_YEAST DDK kinase regulatory subunit DBF4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF4 PE=1 SV=2 254 387 3.0E-13
sp|O59836|HIM1_SCHPO Hsk1-interacting molecule 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=him1 PE=1 SV=1 615 666 1.0E-12
sp|Q9Y7J1|SPO6_SCHPO Sporulation-specific protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo6 PE=3 SV=1 256 401 2.0E-10
sp|Q9Y7J1|SPO6_SCHPO Sporulation-specific protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo6 PE=3 SV=1 615 666 6.0E-08
sp|Q9Y7J1|SPO6_SCHPO Sporulation-specific protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo6 PE=3 SV=1 121 173 2.0E-07
sp|P32325|DBF4_YEAST DDK kinase regulatory subunit DBF4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF4 PE=1 SV=2 612 665 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5228
MSPPPRVPLANNPNAANSPLRGQSLLAYVKHKRPTAYNVCHDTDAKPPPAKRQAFQGASHRRAISPAKHRSHLAA
HRPSLASAASFAAHPAHSTARQLAHRERSRQPSVVRASHDIDNEVWRQHYSAKFPKMVFYFDSIPDDTRAKLTKR
IAYFGARQEPFFSIEVTHVITTRVIPCETRGDAIDARQSGTNEPATPSLKQQDSTEQQPETINPSLLDRSTAARR
KLLFDFRQASTASVAVVDNAATAKRTKPRNNDVLHKAREMGKKIWSLDKFQTMLSVLLDTASPSAPPRVSTGMRG
QLPVSRSFQEPSLIQLLHNERLNGPSDRDPTAINRELIYFKGPYIYVWDMDERQKPLMVREYPKVVVKSEGEWPQ
FRSVGNGRCPFVEESEARERQRRKTRVSQTARAPVNAPAETCAVSKANTASHHPCTKLAAQREAAPSPPLVKSIT
GKRTFAEMQDLNRAVPPEADTFNPAKAILSKANFTRGETLAQPNHAFISRGEGTRLFAGEPVASGLQPSNVTSAI
RSQRVSSTSGIHGAKAGTSKEIYGLQRKVLQKATPAPQDAVSRRLIDVSAEVVSSVSTATCRQTSKTMQDDTTRR
VIETKEKQVHPQLVKSKKDAKPGYCENCQEKFNDFDEHIVTRTHRKFAENDDNWAELDQLLTCLRRLPKYSSMIM
DEESSCAW*
Coding >OphauG2|5228
ATGTCACCCCCGCCCAGGGTCCCTCTGGCCAACAACCCCAATGCCGCTAACTCGCCTCTACGGGGTCAGTCGCTG
CTGGCATATGTCAAGCACAAGCGTCCCACGGCCTATAATGTGTGCCACGACACGGATGCCAAACCCCCGCCCGCC
AAGAGACAGGCTTTTCAAGGCGCCTCCCACCGCCGTGCCATCTCTCCCGCCAAGCATCGCTCGCACTTGGCTGCC
CACCGCCCAAGTCTTGCCTCGGCCGCCTCTTTTGCTGCTCATCCGGCACATTCCACTGCTCGCCAACTGGCACAT
CGGGAACGCTCAAGGCAACCATCTGTCGTGAGAGCCAGCCATGATATCGACAATGAAGTTTGGAGGCAGCATTAT
AGCGCCAAGTTTCCCAAAATGGTCTTCTACTTTGATAGCATCCCCGATGACACCAGGGCCAAGCTAACAAAACGC
ATTGCTTATTTTGGTGCGCGCCAAGAGCCTTTCTTCTCAATCGAGGTCACGCATGTCATTACCACACGCGTAATA
CCTTGTGAGACTCGTGGAGACGCCATCGATGCCCGACAGTCTGGTACCAACGAACCTGCAACCCCATCCCTGAAG
CAGCAAGACTCTACTGAGCAGCAGCCCGAGACTATTAATCCTTCTCTGCTGGACCGAAGCACTGCCGCTCGTCGG
AAGCTTCTATTTGATTTCCGCCAGGCGTCGACTGCATCTGTGGCGGTTGTTGACAACGCAGCGACTGCGAAGCGA
ACCAAGCCTCGAAACAATGATGTGCTTCACAAGGCTCGAGAAATGGGCAAAAAGATATGGTCACTGGACAAGTTT
CAAACCATGCTGTCGGTTCTCCTCGACACTGCTTCACCAAGTGCACCCCCCCGGGTGTCGACTGGCATGCGAGGC
CAGCTTCCCGTGTCGAGAAGCTTCCAGGAACCCAGCCTGATCCAGCTCCTTCACAATGAACGTCTCAATGGACCA
TCTGATCGAGATCCCACTGCTATCAATAGAGAGCTCATTTACTTCAAGGGACCCTATATATACGTTTGGGACATG
GATGAACGCCAAAAGCCCCTCATGGTTCGCGAATATCCCAAGGTTGTTGTTAAATCCGAAGGCGAATGGCCACAG
TTTCGCAGCGTCGGTAATGGACGCTGCCCCTTTGTCGAGGAAAGCGAGGCACGCGAAAGGCAGCGTCGAAAGACT
CGAGTCAGCCAAACAGCACGTGCCCCTGTAAACGCCCCCGCGGAGACTTGTGCTGTTTCGAAAGCAAACACGGCT
TCCCATCACCCATGTACAAAGCTCGCTGCGCAGAGAGAGGCAGCTCCATCGCCGCCTTTGGTCAAGTCAATTACG
GGAAAACGGACCTTTGCTGAAATGCAGGACCTCAACAGGGCTGTGCCTCCTGAGGCAGACACGTTTAACCCAGCC
AAAGCAATTCTTTCCAAGGCCAACTTTACCCGAGGTGAGACGCTGGCTCAGCCCAACCATGCCTTCATCAGCCGC
GGCGAGGGAACGCGGCTGTTTGCTGGAGAACCCGTGGCATCAGGCCTGCAGCCGTCAAACGTCACGTCAGCCATT
CGCTCCCAAAGGGTGTCTTCGACATCTGGAATTCACGGCGCCAAGGCTGGGACAAGCAAGGAGATTTATGGCTTG
CAAAGAAAAGTGTTGCAAAAAGCAACCCCAGCCCCTCAAGATGCTGTGTCGCGCCGCTTGATTGACGTATCTGCC
GAGGTTGTATCTAGTGTGTCGACGGCAACTTGTCGTCAGACATCCAAGACGATGCAAGATGACACCACTCGACGT
GTCATAGAAACCAAGGAGAAACAAGTCCATCCACAGCTCGTCAAGAGCAAAAAGGACGCCAAACCCGGCTACTGT
GAGAACTGTCAGGAAAAGTTCAACGATTTTGATGAGCACATTGTGACTCGCACACACCGAAAATTTGCCGAAAAC
GATGACAATTGGGCCGAACTAGATCAATTGCTCACTTGCCTAAGGCGACTGCCCAAATACTCGAGCATGATAATG
GATGAAGAGTCGTCATGTGCATGGTGA
Transcript >OphauG2|5228
ATGTCACCCCCGCCCAGGGTCCCTCTGGCCAACAACCCCAATGCCGCTAACTCGCCTCTACGGGGTCAGTCGCTG
CTGGCATATGTCAAGCACAAGCGTCCCACGGCCTATAATGTGTGCCACGACACGGATGCCAAACCCCCGCCCGCC
AAGAGACAGGCTTTTCAAGGCGCCTCCCACCGCCGTGCCATCTCTCCCGCCAAGCATCGCTCGCACTTGGCTGCC
CACCGCCCAAGTCTTGCCTCGGCCGCCTCTTTTGCTGCTCATCCGGCACATTCCACTGCTCGCCAACTGGCACAT
CGGGAACGCTCAAGGCAACCATCTGTCGTGAGAGCCAGCCATGATATCGACAATGAAGTTTGGAGGCAGCATTAT
AGCGCCAAGTTTCCCAAAATGGTCTTCTACTTTGATAGCATCCCCGATGACACCAGGGCCAAGCTAACAAAACGC
ATTGCTTATTTTGGTGCGCGCCAAGAGCCTTTCTTCTCAATCGAGGTCACGCATGTCATTACCACACGCGTAATA
CCTTGTGAGACTCGTGGAGACGCCATCGATGCCCGACAGTCTGGTACCAACGAACCTGCAACCCCATCCCTGAAG
CAGCAAGACTCTACTGAGCAGCAGCCCGAGACTATTAATCCTTCTCTGCTGGACCGAAGCACTGCCGCTCGTCGG
AAGCTTCTATTTGATTTCCGCCAGGCGTCGACTGCATCTGTGGCGGTTGTTGACAACGCAGCGACTGCGAAGCGA
ACCAAGCCTCGAAACAATGATGTGCTTCACAAGGCTCGAGAAATGGGCAAAAAGATATGGTCACTGGACAAGTTT
CAAACCATGCTGTCGGTTCTCCTCGACACTGCTTCACCAAGTGCACCCCCCCGGGTGTCGACTGGCATGCGAGGC
CAGCTTCCCGTGTCGAGAAGCTTCCAGGAACCCAGCCTGATCCAGCTCCTTCACAATGAACGTCTCAATGGACCA
TCTGATCGAGATCCCACTGCTATCAATAGAGAGCTCATTTACTTCAAGGGACCCTATATATACGTTTGGGACATG
GATGAACGCCAAAAGCCCCTCATGGTTCGCGAATATCCCAAGGTTGTTGTTAAATCCGAAGGCGAATGGCCACAG
TTTCGCAGCGTCGGTAATGGACGCTGCCCCTTTGTCGAGGAAAGCGAGGCACGCGAAAGGCAGCGTCGAAAGACT
CGAGTCAGCCAAACAGCACGTGCCCCTGTAAACGCCCCCGCGGAGACTTGTGCTGTTTCGAAAGCAAACACGGCT
TCCCATCACCCATGTACAAAGCTCGCTGCGCAGAGAGAGGCAGCTCCATCGCCGCCTTTGGTCAAGTCAATTACG
GGAAAACGGACCTTTGCTGAAATGCAGGACCTCAACAGGGCTGTGCCTCCTGAGGCAGACACGTTTAACCCAGCC
AAAGCAATTCTTTCCAAGGCCAACTTTACCCGAGGTGAGACGCTGGCTCAGCCCAACCATGCCTTCATCAGCCGC
GGCGAGGGAACGCGGCTGTTTGCTGGAGAACCCGTGGCATCAGGCCTGCAGCCGTCAAACGTCACGTCAGCCATT
CGCTCCCAAAGGGTGTCTTCGACATCTGGAATTCACGGCGCCAAGGCTGGGACAAGCAAGGAGATTTATGGCTTG
CAAAGAAAAGTGTTGCAAAAAGCAACCCCAGCCCCTCAAGATGCTGTGTCGCGCCGCTTGATTGACGTATCTGCC
GAGGTTGTATCTAGTGTGTCGACGGCAACTTGTCGTCAGACATCCAAGACGATGCAAGATGACACCACTCGACGT
GTCATAGAAACCAAGGAGAAACAAGTCCATCCACAGCTCGTCAAGAGCAAAAAGGACGCCAAACCCGGCTACTGT
GAGAACTGTCAGGAAAAGTTCAACGATTTTGATGAGCACATTGTGACTCGCACACACCGAAAATTTGCCGAAAAC
GATGACAATTGGGCCGAACTAGATCAATTGCTCACTTGCCTAAGGCGACTGCCCAAATACTCGAGCATGATAATG
GATGAAGAGTCGTCATGTGCATGGTGA
Gene >OphauG2|5228
ATGTCACCCCCGCCCAGGGTCCCTCTGGCCAACAACCCCAATGCCGCTAACTCGCCTCTACGGGGTCAGTCGCTG
CTGGCATATGTCAAGCACAAGCGTCCCACGGCCTATAATGTGTGCCACGACACGGATGCCAAACCCCCGCCCGCC
AAGAGACAGGCTTTTCAAGGCGCCTCCCACCGCCGTGCCATCTCTCCCGCCAAGCATCGCTCGCACTTGGCTGCC
CACCGCCCAAGTCTTGCCTCGGCCGCCTCTTTTGCTGCTCATCCGGCACATTCCACTGCTCGCCAACTGGCACAT
CGGGAACGCTCAAGGCAACCATCTGTCGTGAGAGCCAGCCATGATATCGACAATGAAGTTTGGAGGCAGCATTAT
AGCGCCAAGTTTCCCAAAATGGTCTTCTACTTTGATAGCATCCCCGATGACACCAGGGCCAAGCTAACAAAACGC
ATTGCTTATTTTGGTGCGGTATGTCGGCTCTGTTTCGTCTTTTCTCACCATCTTGCCACCTTATTCTCCTGTACT
GATGCCCCTGGATCCTCCTTAGCGCCAAGAGCCTTTCTTCTCAATCGAGGTCACGCATGTCATTACCACACGCGT
AATACCTTGTGAGACTCGTGGAGACGCCATCGATGCCCGACAGTCTGGTACCAACGAACCTGCAACCCCATCCCT
GAAGCAGCAAGACTCTACTGAGCAGCAGCCCGAGACTATTAATCCTTCTCTGCTGGACCGAAGCACTGCCGCTCG
TCGGAAGCTTCTATTTGATTTCCGCCAGGCGTCGACTGCATCTGTGGCGGTTGTTGACAACGCAGCGACTGCGAA
GCGAACCAAGCCTCGAAACAATGATGTGCTTCACAAGGCTCGAGAAATGGGCAAAAAGATATGGTCACTGGACAA
GTTTCAAACCATGCTGTCGGTTCTCCTCGACACTGCTTCACCAAGTGCACCCCCCCGGGTGTCGACTGGCATGCG
AGGCCAGCTTCCCGTGTCGAGAAGCTTCCAGGAACCCAGCCTGATCCAGCTCCTTCACAATGAACGTCTCAATGG
ACCATCTGATCGAGATCCCACTGCTATCAATAGAGAGCTCATTTACTTCAAGGGACCCTATATATACGTTTGGGA
CATGGATGAACGCCAAAAGCCCCTCATGGTTCGCGAATATCCCAAGGTTGTTGTTAAATCCGAAGGCGAATGGCC
ACAGTTTCGCAGCGTCGGTAATGGACGCTGCCCCTTTGTCGAGGAAAGCGAGGCACGCGAAAGGCAGCGTCGAAA
GACTCGAGTCAGCCAAACAGCACGTGCCCCTGTAAACGCCCCCGCGGAGACTTGTGCTGTTTCGAAAGCAAACAC
GGCTTCCCATCACCCATGTACAAAGCTCGCTGCGCAGAGAGAGGCAGCTCCATCGCCGCCTTTGGTCAAGTCAAT
TACGGGAAAACGGACCTTTGCTGAAATGCAGGACCTCAACAGGGCTGTGCCTCCTGAGGCAGACACGTTTAACCC
AGCCAAAGCAATTCTTTCCAAGGCCAACTTTACCCGAGGTGAGACGCTGGCTCAGCCCAACCATGCCTTCATCAG
CCGCGGCGAGGGAACGCGGCTGTTTGCTGGAGAACCCGTGGCATCAGGCCTGCAGCCGTCAAACGTCACGTCAGC
CATTCGCTCCCAAAGGGTGTCTTCGACATCTGGAATTCACGGCGCCAAGGCTGGGACAAGCAAGGAGATTTATGG
CTTGCAAAGAAAAGTGTTGCAAAAAGCAACCCCAGCCCCTCAAGATGCTGTGTCGCGCCGCTTGATTGACGTATC
TGCCGAGGTTGTATCTAGTGTGTCGACGGCAACTTGTCGTCAGACATCCAAGACGATGCAAGATGACACCACTCG
ACGTGTCATAGAAACCAAGGAGAAACAAGTCCATCCACAGCTCGTCAAGAGCAAAAAGGACGCCAAACCCGGCTA
CTGTGAGAACTGTCAGGAAAAGTTCAACGATTTTGATGAGGTGAGCAGCCGTTTATTTGGAGGGGCCAAAAGTTG
AGGGACGACTAATATTGATGTCAATAACAACAGCACATTGTGACTCGCACACACCGAAAATTTGCCGAAAACGAT
GACAATTGGGCCGAACTAGATCAATTGCTCACTTGCCTAAGGCGACTGCCCAAATACTCGAGCATGATAATGGAT
GAAGAGTCGTCATGTGCATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail