Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5224
Gene name
LocationContig_470:6506..9929
Strand-
Gene length (bp)3423
Transcript length (bp)3315
Coding sequence length (bp)3315
Protein length (aa) 1105

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00136 DNA_pol_B DNA polymerase family B 1.4E-147 536 967
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 1.5E-81 130 472
PF14260 zf-C4pol C4-type zinc-finger of DNA polymerase delta 4.0E-17 1005 1079

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 53 1097 0.0E+00
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 55 1097 0.0E+00
sp|P15436|DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL3 PE=1 SV=4 61 1096 0.0E+00
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 82 1104 0.0E+00
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 82 1104 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 53 1097 0.0E+00
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 55 1097 0.0E+00
sp|P15436|DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL3 PE=1 SV=4 61 1096 0.0E+00
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 82 1104 0.0E+00
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 82 1104 0.0E+00
sp|O54747|DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus GN=Pold1 PE=2 SV=1 82 1104 0.0E+00
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 87 1104 0.0E+00
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 84 1097 0.0E+00
sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 74 1104 0.0E+00
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 61 1096 0.0E+00
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 83 1096 0.0E+00
sp|Q54N97|DPOD1_DICDI DNA polymerase delta catalytic subunit OS=Dictyostelium discoideum GN=pold1 PE=3 SV=1 73 1099 0.0E+00
sp|P90829|DPOD1_CAEEL DNA polymerase delta catalytic subunit OS=Caenorhabditis elegans GN=F10C2.4 PE=3 SV=1 54 1096 0.0E+00
sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD1 PE=2 SV=1 61 1001 0.0E+00
sp|P30315|DPOD1_PLAFK DNA polymerase delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) GN=POLD1 PE=3 SV=1 124 1099 0.0E+00
sp|P30321|DPOL_PBCV1 DNA polymerase OS=Paramecium bursaria Chlorella virus 1 GN=DPO PE=3 SV=2 124 976 6.0E-122
sp|Q3KSP1|DPOL_EBVG DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain GD1) GN=BALF5 PE=3 SV=1 123 956 2.0E-117
sp|P30320|DPOL_PBCVN DNA polymerase OS=Paramecium bursaria Chlorella virus NY2A GN=DPO PE=3 SV=1 124 976 2.0E-117
sp|Q1HVC1|DPOL_EBVA8 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain AG876) GN=BALF5 PE=3 SV=1 123 956 2.0E-117
sp|P03198|DPOL_EBVB9 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain B95-8) GN=BALF5 PE=1 SV=1 123 956 7.0E-117
sp|O36363|DPOL_ALHV1 DNA polymerase catalytic subunit OS=Alcelaphine herpesvirus 1 (strain C500) GN=9 PE=3 SV=1 123 953 2.0E-109
sp|Q2HRD0|DPOL_HHV8P DNA polymerase catalytic subunit OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF9 PE=3 SV=1 241 953 1.0E-105
sp|P24907|DPOL_SHV21 DNA polymerase catalytic subunit OS=Saimiriine herpesvirus 2 (strain 11) GN=9 PE=3 SV=1 122 971 1.0E-104
sp|Q69025|DPOL_GPCMV DNA polymerase OS=Guinea pig cytomegalovirus (strain 22122) GN=UL54 PE=3 SV=3 122 974 2.0E-103
sp|Q9QJ32|DPOL_HHV6Z DNA polymerase catalytic subunit OS=Human herpesvirus 6B (strain Z29) GN=U38 PE=3 SV=1 122 968 1.0E-101
sp|P28857|DPOL_HHV6U DNA polymerase catalytic subunit OS=Human herpesvirus 6A (strain Uganda-1102) GN=U38 PE=3 SV=1 122 968 6.0E-101
sp|P52367|DPOL_EHV2 DNA polymerase catalytic subunit OS=Equine herpesvirus 2 (strain 86/87) GN=9 PE=3 SV=1 241 953 1.0E-99
sp|O71121|DPOL_RHCM6 DNA polymerase catalytic subunit OS=Rhesus cytomegalovirus (strain 68-1) GN=UL54 PE=3 SV=1 123 974 4.0E-99
sp|P52342|DPOL_HHV7J DNA polymerase catalytic subunit OS=Human herpesvirus 7 (strain JI) GN=U38 PE=3 SV=1 123 978 1.0E-97
sp|Q9DKT8|DPOL_ELHVK DNA polymerase catalytic subunit OS=Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) PE=3 SV=1 122 970 2.0E-91
sp|P27172|DPOL_MUHVS DNA polymerase catalytic subunit OS=Murid herpesvirus 1 (strain Smith) GN=UL54 PE=3 SV=1 122 968 1.0E-87
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 305 1086 1.0E-87
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 305 1082 6.0E-81
sp|Q6UDK1|DPOL_PSHV1 DNA polymerase catalytic subunit OS=Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) GN=UL30 PE=3 SV=1 235 972 6.0E-80
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 305 1089 2.0E-79
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 346 1089 7.0E-79
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 363 1088 1.0E-78
sp|Q9E6N9|DPOL_GAHVM DNA polymerase catalytic subunit OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV043 PE=3 SV=1 122 969 5.0E-71
sp|P28858|DPOL_EHV1B DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain Ab4p) GN=30 PE=3 SV=1 266 969 5.0E-71
sp|P09252|DPOL_VZVD DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Dumas) GN=ORF28 PE=3 SV=1 271 957 2.0E-70
sp|Q6S6P1|DPOL_EHV1V DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain V592) GN=30 PE=3 SV=1 266 969 2.0E-70
sp|Q4JQU7|DPOL_VZVO DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF28 PE=3 SV=1 271 957 2.0E-70
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 478 963 6.0E-69
sp|P09854|DPOL_HHV1S DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain SC16) GN=UL30 PE=3 SV=1 296 921 9.0E-68
sp|P07917|DPOL_HHV1A DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain Angelotti) GN=UL30 PE=1 SV=1 296 921 1.0E-67
sp|P04293|DPOL_HHV11 DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain 17) GN=UL30 PE=1 SV=2 296 921 1.0E-67
sp|P04292|DPOL_HHV1K DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain KOS) GN=UL30 PE=1 SV=1 296 921 2.0E-67
sp|P89453|DPOL_HHV2H DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain HG52) GN=UL30 PE=3 SV=1 296 921 4.0E-67
sp|P07918|DPOL_HHV21 DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain 186) GN=UL30 PE=3 SV=1 296 921 1.0E-65
sp|P56689|DPOL_THEGO DNA polymerase OS=Thermococcus gorgonarius GN=pol PE=1 SV=1 305 964 9.0E-63
sp|P61876|DPOL_PYRWO DNA polymerase OS=Pyrococcus woesei GN=pol PE=1 SV=1 305 965 5.0E-62
sp|P61875|DPOL_PYRFU DNA polymerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pol PE=1 SV=1 305 965 5.0E-62
sp|P0CL77|DPOL_PYRAB DNA polymerase 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=polI PE=1 SV=1 303 964 4.0E-59
sp|Q56366|DPOL_THES9 DNA polymerase OS=Thermococcus sp. (strain 9oN-7) GN=pol PE=1 SV=1 300 965 9.0E-59
sp|P0CL76|DPOL_PYRAY DNA polymerase 1 OS=Pyrococcus abyssi GN=polI PE=1 SV=1 303 964 2.0E-58
sp|O93746|DPOL2_AERPE DNA polymerase 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polB PE=3 SV=3 105 975 8.0E-58
sp|Q9HH06|DPOL_PYRGL DNA polymerase OS=Pyrococcus glycovorans GN=pol PE=3 SV=1 303 965 6.0E-57
sp|O70736|DPOL_RSIV DNA polymerase OS=Red sea bream iridovirus PE=3 SV=1 124 992 9.0E-57
sp|Q7SIG7|DPOL_DESST DNA polymerase OS=Desulfurococcus sp. (strain Tok) GN=pol PE=1 SV=1 305 964 3.0E-54
sp|Q85428|DPOL_RCMVM DNA polymerase catalytic subunit OS=Rat cytomegalovirus (strain Maastricht) GN=UL54 PE=3 SV=2 570 1032 4.0E-54
sp|P08546|DPOL_HCMVA DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain AD169) GN=UL54 PE=1 SV=2 577 974 1.0E-53
sp|Q6SW77|DPOL_HCMVM DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain Merlin) GN=UL54 PE=3 SV=1 577 974 2.0E-53
sp|O29753|DPOL_ARCFU DNA polymerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pol PE=3 SV=1 305 965 5.0E-53
sp|P27727|DPOLA_TRYBB DNA polymerase alpha catalytic subunit OS=Trypanosoma brucei brucei PE=3 SV=1 330 984 2.0E-51
sp|O89042|DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus GN=Pola1 PE=2 SV=1 248 969 3.0E-51
sp|Q27152|DPOLA_OXYTR DNA polymerase alpha catalytic subunit OS=Oxytricha trifallax PE=3 SV=1 363 969 9.0E-49
sp|P33609|DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus GN=Pola1 PE=1 SV=2 382 969 1.0E-48
sp|Q9FHA3|DPOLA_ARATH DNA polymerase alpha catalytic subunit OS=Arabidopsis thaliana GN=POLA PE=3 SV=2 360 975 3.0E-48
sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens GN=POLA1 PE=1 SV=2 248 969 3.0E-48
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 122 618 8.0E-48
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 122 618 1.0E-47
sp|O00874|DPOLA_LEIDO DNA polymerase alpha catalytic subunit OS=Leishmania donovani PE=3 SV=1 363 975 3.0E-47
sp|Q94636|DPOLA_STENO DNA polymerase alpha catalytic subunit OS=Sterkiella nova PE=3 SV=1 366 969 3.0E-46
sp|P52025|DPOL_METVO DNA polymerase OS=Methanococcus voltae GN=pol PE=3 SV=1 305 979 1.0E-45
sp|Q9DE46|DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis GN=pola1 PE=1 SV=1 248 977 2.0E-45
sp|P28040|DPOA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol1 PE=1 SV=1 369 975 4.0E-43
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 643 974 5.0E-43
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 643 974 5.0E-43
sp|O48653|DPOLA_ORYSJ DNA polymerase alpha catalytic subunit OS=Oryza sativa subsp. japonica GN=Os01g0868300 PE=2 SV=2 359 975 1.0E-42
sp|Q196U0|DPOL_IIV3 DNA polymerase 120R OS=Invertebrate iridescent virus 3 GN=IIV3-120R PE=3 SV=1 307 616 3.0E-42
sp|O27276|DPOL1_METTH DNA polymerase PolB subunit 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB1 PE=1 SV=1 195 760 3.0E-40
sp|Q54SV8|DPOLA_DICDI DNA polymerase alpha catalytic subunit OS=Dictyostelium discoideum GN=pola1 PE=3 SV=1 322 967 8.0E-40
sp|P26019|DPOLA_DROME DNA polymerase alpha catalytic subunit OS=Drosophila melanogaster GN=DNApol-alpha180 PE=1 SV=2 124 975 3.0E-39
sp|A7U6F3|DPOL_PPV01 DNA polymerase OS=Phaeocystis pouchetii virus GN=dpo PE=3 SV=1 464 785 6.0E-37
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 470 737 7.0E-37
sp|P13382|DPOA_YEAST DNA polymerase alpha catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL1 PE=1 SV=2 576 975 4.0E-36
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 303 697 3.0E-34
sp|P21189|DPO2_ECOLI DNA polymerase II OS=Escherichia coli (strain K12) GN=polB PE=1 SV=2 230 976 2.0E-33
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 363 619 2.0E-30
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 303 697 3.0E-30
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 746 968 8.0E-30
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 305 697 1.0E-28
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 305 697 2.0E-28
sp|Q6WI70|DPOL_BPKVM DNA polymerase OS=Vibrio phage KVP40 (isolate Vibrio parahaemolyticus/Japan/Matsuzaki/1991) GN=43 PE=3 SV=1 302 861 4.0E-27
sp|Q4U3V0|DPOL_TNAVC DNA polymerase OS=Trichoplusia ni ascovirus 2c GN=ORF1 PE=3 SV=2 649 971 4.0E-27
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 305 730 8.0E-27
sp|A4KX57|DPOL_HVAVE DNA polymerase OS=Heliothis virescens ascovirus 3e GN=ORF1 PE=3 SV=1 647 880 1.0E-26
sp|P08546|DPOL_HCMVA DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain AD169) GN=UL54 PE=1 SV=2 123 585 5.0E-25
sp|Q6SW77|DPOL_HCMVM DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain Merlin) GN=UL54 PE=3 SV=1 123 585 5.0E-25
sp|O05706|DPOL3_SULSH DNA polymerase 3 OS=Sulfolobus shibatae GN=dpo3 PE=3 SV=1 241 975 6.0E-25
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 746 968 3.0E-24
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 643 881 2.0E-23
sp|Q83948|DPOL_NPVOP DNA polymerase OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=POL PE=3 SV=1 295 921 2.0E-23
sp|Q85428|DPOL_RCMVM DNA polymerase catalytic subunit OS=Rat cytomegalovirus (strain Maastricht) GN=UL54 PE=3 SV=2 122 564 8.0E-23
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 456 615 3.0E-22
sp|Q196U0|DPOL_IIV3 DNA polymerase 120R OS=Invertebrate iridescent virus 3 GN=IIV3-120R PE=3 SV=1 650 968 4.0E-22
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 693 975 4.0E-22
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 319 478 5.0E-22
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 120 484 3.0E-21
sp|Q90162|DPOL_NPVCF DNA polymerase OS=Choristoneura fumiferana nuclear polyhedrosis virus GN=POL PE=3 SV=1 295 930 4.0E-21
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 647 896 6.0E-21
sp|Q779J8|DPOL_SFAVA DNA polymerase OS=Spodoptera frugiperda ascovirus 1a GN=ORF1 PE=3 SV=1 647 838 1.0E-20
sp|O50607|DPOL1_SULOH DNA polymerase 1 OS=Sulfurisphaera ohwakuensis GN=pol-alpha PE=3 SV=1 192 928 3.0E-20
sp|P42489|DPOL_ASFB7 DNA polymerase beta OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=DPOL PE=3 SV=1 307 954 1.0E-19
sp|P43139|DPOL_ASFL6 DNA polymerase beta OS=African swine fever virus (isolate Pig/Portugal/Lis 60/1960) GN=DPOL PE=3 SV=1 307 954 1.0E-19
sp|P0C974|DPOL_ASFK5 DNA polymerase beta OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-102 PE=3 SV=1 307 954 2.0E-19
sp|P0C972|DPOL_ASFM2 DNA polymerase beta OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-098 PE=3 SV=1 307 954 4.0E-19
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 688 965 1.0E-18
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 710 964 1.0E-18
sp|P21402|DPOL_FOWPN DNA polymerase OS=Fowlpox virus (strain NVSL) GN=POL PE=3 SV=2 465 921 2.0E-18
sp|P26811|DPOL1_SULSO DNA polymerase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dpo1 PE=1 SV=2 197 928 2.0E-18
sp|P95979|DPOL3_SULSO DNA polymerase 3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dpo3 PE=3 SV=1 124 961 4.0E-18
sp|Q779J8|DPOL_SFAVA DNA polymerase OS=Spodoptera frugiperda ascovirus 1a GN=ORF1 PE=3 SV=1 389 620 9.0E-18
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 121 484 1.0E-17
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 649 753 1.0E-17
sp|Q84173|DPOL_ORFN2 DNA polymerase OS=Orf virus (strain NZ2) GN=POL PE=3 SV=1 503 952 2.0E-17
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 693 965 3.0E-17
sp|P18131|DPOL_NPVAC DNA polymerase OS=Autographa californica nuclear polyhedrosis virus GN=POL PE=3 SV=2 310 857 3.0E-17
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 305 599 6.0E-17
sp|P41712|DPOL_NPVBM DNA polymerase OS=Bombyx mori nuclear polyhedrosis virus GN=POL PE=3 SV=2 310 857 6.0E-17
sp|P33793|DPOL_VAR67 DNA polymerase OS=Variola virus (isolate Human/India/Ind3/1967) GN=POL PE=3 SV=1 503 831 1.0E-16
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 305 599 1.0E-16
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 318 486 2.0E-16
sp|O57191|DPOL_VACCA DNA polymerase OS=Vaccinia virus (strain Ankara) GN=POL PE=3 SV=1 503 831 2.0E-16
sp|P20509|DPOL_VACCC DNA polymerase OS=Vaccinia virus (strain Copenhagen) GN=POL PE=3 SV=1 503 831 2.0E-16
sp|P06856|DPOL_VACCW DNA polymerase OS=Vaccinia virus (strain Western Reserve) GN=POL PE=1 SV=5 503 831 3.0E-16
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 708 965 5.0E-16
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 740 965 6.0E-16
sp|P30318|DPOL_NPVLD DNA polymerase OS=Lymantria dispar multicapsid nuclear polyhedrosis virus GN=POL PE=3 SV=2 361 766 1.0E-15
sp|A4KX57|DPOL_HVAVE DNA polymerase OS=Heliothis virescens ascovirus 3e GN=ORF1 PE=3 SV=1 389 619 2.0E-15
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 303 599 3.0E-15
sp|P04415|DPOL_BPT4 DNA polymerase OS=Enterobacteria phage T4 GN=43 PE=1 SV=1 364 862 3.0E-15
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 575 782 7.0E-15
sp|O93745|DPOL1_AERPE DNA polymerase 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polA PE=3 SV=2 360 928 1.0E-14
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 502 619 8.0E-14
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 740 965 2.0E-13
sp|P95690|DPOL1_SULAC DNA polymerase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=dpo1 PE=1 SV=2 196 928 2.0E-13
sp|Q38087|DPOL_BPR69 DNA polymerase OS=Enterobacteria phage RB69 GN=43 PE=1 SV=1 364 911 3.0E-13
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 731 965 2.0E-12
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 402 607 2.0E-12
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 731 964 5.0E-12
sp|P30319|DPOL_CBEPV DNA polymerase OS=Choristoneura biennis entomopoxvirus GN=POL PE=3 SV=1 481 847 2.0E-11
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 386 599 8.0E-11
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 104 322 2.0E-10
sp|A7U6F3|DPOL_PPV01 DNA polymerase OS=Phaeocystis pouchetii virus GN=dpo PE=3 SV=1 121 341 2.0E-09
sp|O26310|DPOL2_METTH DNA polymerase PolB subunit 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB2 PE=1 SV=1 777 967 1.0E-08
sp|Q4U3V0|DPOL_TNAVC DNA polymerase OS=Trichoplusia ni ascovirus 2c GN=ORF1 PE=3 SV=2 361 636 1.0E-07
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 548 697 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3880
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5224 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3598
Ophiocordyceps camponoti-floridani Ophcf2|04892
Ophiocordyceps camponoti-rufipedis Ophun1|5205
Ophiocordyceps kimflemingae Ophio5|5197
Ophiocordyceps subramaniannii Hirsu2|7702

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5224
MASTRLPQKRVLGDVGTRQNITSPISAKRRKPDVFSSSPAARFSGSQRDPRAKLGSSQPTKSVFESEVLEKMSQD
ISDLKKNNAEKDQKWERPPVVEFDSRQVNLCFQAIEAEEGTLHDGKTTVKLFGVTDAGNSVMLHVTDFKHYIYVP
APPLFQPQDTVAFKAYLETQIAQHQPAIHSITLCPRESIYGFQGNKKSHFLKITVNDPKFIPKVRSTIEHGDADW
KGMWKARESGVMTYDNIQYVLRFMVDCHIQGMSWVEAPATKYSLIPNNRRQSNCQIEAEVSYGHLIAHKPDGEWA
KMAPLRILSFDIECAGRKGIFPEANHDPVIQIANVVTKYGEKKPFIRNVFCLDTTSSIVATQVLEFEQEEKMLSA
WQQFLLKVDPDIIIGYNISNFDFPYLLDRAKHLKVNGFEYWSRIPSVPSKVRDTNFSSKQIGNRDTKETNTNGRL
QLDLLQLVQRDHHLRSYTLNSVCAHFLGEQKEDVHHSMITELYNGTPESRRRLALYCLKDAYLPQRLMDKLSCLE
NYTEMARVTGVPFNFLLSRGQQIKFISQLFRKALEQKLVIPNLKSQKSDEQYEGATVIEPTRGYYDVPIATLDFA
SLYPSIIQAHNLCYTTLLDKKLIEPFGLKKDEDYIVTPNGDLFVTAKQRRGLLAQILEELLTARKQAKRELAQET
DPFRKAVLNGRQLALKISANSVYGLTGATTGKLPCLAIASSTTSFGRQMIEKTKAEVEARYNIANGYSHDAQVIY
GDTDSVMVKFGTKELAEAMKLGEEAAQYVSSKFVKPIKLEFEKVYFPYLLINKKRYAGLFWTKTEKYDKMDTKGI
ETVRRDNCLLVQTVIEKVLRMILIERDVQGAQDYVKDTIADLLQNKVDMSKLVITKALTKEDYTAKQAHVELAQR
MKKRDAGSAPGLGDRVAYVMVRGAAGAKNFEKSEDPLYVLENNVPIDTKYYLDNQLAKPLGRIFEPILGESKARL
LLTGDHTRTISVAAPTVGGLMKFARKTQTCMGCKKPLRGEQESAGAVCGDCGPRVGELYKRTLDRVSELEVRFGR
LWTQCQRCQGSMHCEVICSSKDCPIFYMRMKARKDLEDAGKELSRFDADQAAMW*
Coding >OphauG2|5224
ATGGCCAGTACGCGTCTGCCGCAGAAGCGAGTGCTCGGGGACGTGGGCACTCGCCAGAACATCACCAGTCCCATA
TCGGCCAAGAGACGCAAGCCCGATGTTTTCTCATCGTCCCCCGCCGCACGATTTTCCGGCTCGCAGAGAGATCCG
CGGGCCAAGCTGGGGTCCAGCCAGCCGACCAAGAGCGTCTTCGAGTCCGAAGTGCTCGAGAAGATGAGCCAGGAC
ATCTCGGACTTGAAAAAGAACAATGCCGAAAAAGATCAGAAATGGGAGCGGCCGCCTGTGGTGGAATTTGATTCT
CGACAGGTCAACTTGTGCTTCCAGGCAATAGAGGCTGAAGAGGGTACCCTCCACGACGGAAAGACAACAGTCAAG
CTGTTTGGAGTTACAGATGCGGGCAATTCTGTCATGCTGCACGTTACCGACTTCAAACACTATATATATGTGCCG
GCACCGCCTCTATTTCAGCCTCAAGATACGGTGGCGTTCAAGGCCTATCTCGAGACACAGATTGCTCAACACCAG
CCTGCAATCCATTCGATTACTCTCTGCCCCAGAGAAAGCATTTACGGCTTCCAGGGGAACAAGAAGAGCCATTTT
CTCAAAATTACTGTCAACGATCCCAAATTTATTCCCAAAGTTCGCTCCACCATCGAACATGGCGATGCGGATTGG
AAAGGCATGTGGAAGGCAAGAGAGAGCGGTGTCATGACTTATGACAATATCCAATACGTCTTGCGATTCATGGTG
GACTGCCACATCCAAGGCATGTCATGGGTAGAGGCGCCAGCAACCAAGTACAGTCTCATCCCCAATAACAGGAGA
CAGTCAAACTGTCAGATTGAGGCCGAGGTCAGCTATGGGCACCTAATCGCGCACAAGCCCGACGGCGAATGGGCC
AAAATGGCTCCTTTGCGGATTCTCTCCTTCGACATTGAGTGTGCCGGACGAAAAGGCATATTTCCAGAGGCCAAT
CACGACCCTGTTATCCAAATAGCCAACGTGGTGACAAAATATGGAGAGAAGAAGCCGTTTATTCGTAATGTCTTT
TGCTTGGACACGACAAGCTCTATTGTGGCCACACAGGTGCTCGAGTTCGAACAAGAAGAAAAGATGCTGAGTGCA
TGGCAGCAGTTCTTGCTCAAAGTTGACCCCGACATCATTATTGGCTACAACATCTCCAACTTTGACTTTCCGTAT
CTGCTAGACCGAGCAAAGCACCTTAAGGTCAACGGATTCGAATACTGGTCCCGTATTCCGAGTGTACCGTCAAAG
GTCAGAGATACAAATTTCTCAAGTAAACAGATAGGCAATCGTGACACGAAGGAAACCAACACGAACGGCAGGTTA
CAGCTCGATCTATTACAACTGGTTCAACGTGACCACCACCTAAGAAGCTATACACTAAACTCGGTCTGCGCGCAC
TTTCTAGGAGAACAAAAAGAAGATGTGCACCACAGCATGATTACAGAACTCTACAATGGAACACCAGAGTCTCGC
AGGCGTCTGGCATTGTACTGTTTAAAGGACGCATATCTGCCGCAAAGGCTTATGGACAAGCTTTCCTGCCTCGAA
AATTATACAGAGATGGCTAGAGTGACGGGTGTGCCTTTCAACTTTTTGCTGTCGCGCGGTCAGCAGATCAAGTTC
ATCAGTCAACTGTTCCGCAAAGCGTTGGAGCAGAAACTCGTCATTCCAAATCTTAAATCGCAAAAATCCGATGAA
CAGTATGAGGGCGCCACCGTTATCGAGCCCACACGTGGCTATTACGACGTCCCTATTGCGACTCTTGATTTTGCT
TCGCTGTACCCAAGTATCATACAAGCACATAACCTCTGTTACACGACGTTACTTGACAAGAAACTCATTGAGCCC
TTTGGCCTGAAAAAGGACGAGGATTACATTGTAACTCCCAATGGCGATCTGTTTGTAACGGCCAAACAGAGAAGA
GGGCTCTTGGCGCAAATCCTCGAGGAACTTTTGACGGCACGCAAACAGGCGAAGCGGGAGCTTGCACAGGAAACT
GACCCTTTCAGAAAAGCAGTGCTAAACGGTCGTCAATTGGCACTCAAGATTAGCGCCAACAGTGTGTACGGGTTG
ACGGGTGCAACAACAGGAAAGCTGCCTTGTCTCGCAATCGCCAGTAGTACCACGAGTTTTGGTCGCCAAATGATT
GAGAAGACGAAGGCCGAGGTGGAAGCGCGGTATAATATCGCCAACGGGTATAGTCACGACGCACAGGTGATTTAC
GGCGACACGGATTCAGTCATGGTCAAGTTTGGCACCAAAGAGTTGGCTGAGGCGATGAAGCTGGGCGAGGAGGCG
GCGCAATACGTGTCGTCAAAGTTTGTCAAGCCCATCAAGCTCGAGTTTGAAAAGGTTTACTTTCCATACCTGCTC
ATCAACAAGAAGCGGTACGCGGGTCTATTCTGGACCAAGACGGAAAAGTACGACAAGATGGACACCAAGGGTATT
GAGACTGTGCGACGAGACAATTGTCTGCTAGTGCAGACAGTGATTGAAAAGGTGCTGAGGATGATACTCATTGAG
CGAGACGTGCAGGGCGCGCAAGACTACGTCAAGGACACGATTGCAGACTTGCTGCAAAACAAGGTGGACATGTCG
AAGCTAGTCATCACCAAGGCCCTGACCAAGGAAGACTACACAGCCAAACAAGCTCATGTGGAGCTTGCGCAGCGT
ATGAAGAAGCGCGACGCGGGCTCAGCTCCAGGACTGGGAGACCGAGTGGCCTATGTCATGGTGAGAGGGGCGGCA
GGAGCCAAGAATTTTGAGAAATCAGAGGATCCCCTCTACGTGTTGGAAAACAATGTGCCGATTGACACCAAGTAC
TATCTCGACAACCAATTGGCGAAGCCACTGGGGCGCATTTTTGAGCCCATCTTGGGGGAATCCAAGGCTCGGCTG
CTGCTGACTGGAGACCACACGCGAACAATATCGGTGGCGGCGCCGACGGTGGGGGGGCTGATGAAGTTTGCGCGC
AAGACACAGACATGCATGGGGTGCAAGAAGCCGCTCCGAGGGGAGCAAGAAAGCGCGGGGGCAGTATGCGGCGAC
TGCGGGCCGCGTGTGGGAGAACTGTATAAGCGGACGCTGGATCGCGTGTCGGAGCTCGAAGTGCGGTTTGGGAGG
CTATGGACGCAGTGCCAGCGGTGTCAGGGCAGCATGCACTGCGAGGTGATTTGCAGCAGCAAGGACTGTCCCATT
TTCTACATGCGCATGAAGGCGAGAAAGGACCTGGAGGATGCGGGCAAGGAGCTGAGTCGGTTTGACGCAGACCAG
GCAGCCATGTGGTGA
Transcript >OphauG2|5224
ATGGCCAGTACGCGTCTGCCGCAGAAGCGAGTGCTCGGGGACGTGGGCACTCGCCAGAACATCACCAGTCCCATA
TCGGCCAAGAGACGCAAGCCCGATGTTTTCTCATCGTCCCCCGCCGCACGATTTTCCGGCTCGCAGAGAGATCCG
CGGGCCAAGCTGGGGTCCAGCCAGCCGACCAAGAGCGTCTTCGAGTCCGAAGTGCTCGAGAAGATGAGCCAGGAC
ATCTCGGACTTGAAAAAGAACAATGCCGAAAAAGATCAGAAATGGGAGCGGCCGCCTGTGGTGGAATTTGATTCT
CGACAGGTCAACTTGTGCTTCCAGGCAATAGAGGCTGAAGAGGGTACCCTCCACGACGGAAAGACAACAGTCAAG
CTGTTTGGAGTTACAGATGCGGGCAATTCTGTCATGCTGCACGTTACCGACTTCAAACACTATATATATGTGCCG
GCACCGCCTCTATTTCAGCCTCAAGATACGGTGGCGTTCAAGGCCTATCTCGAGACACAGATTGCTCAACACCAG
CCTGCAATCCATTCGATTACTCTCTGCCCCAGAGAAAGCATTTACGGCTTCCAGGGGAACAAGAAGAGCCATTTT
CTCAAAATTACTGTCAACGATCCCAAATTTATTCCCAAAGTTCGCTCCACCATCGAACATGGCGATGCGGATTGG
AAAGGCATGTGGAAGGCAAGAGAGAGCGGTGTCATGACTTATGACAATATCCAATACGTCTTGCGATTCATGGTG
GACTGCCACATCCAAGGCATGTCATGGGTAGAGGCGCCAGCAACCAAGTACAGTCTCATCCCCAATAACAGGAGA
CAGTCAAACTGTCAGATTGAGGCCGAGGTCAGCTATGGGCACCTAATCGCGCACAAGCCCGACGGCGAATGGGCC
AAAATGGCTCCTTTGCGGATTCTCTCCTTCGACATTGAGTGTGCCGGACGAAAAGGCATATTTCCAGAGGCCAAT
CACGACCCTGTTATCCAAATAGCCAACGTGGTGACAAAATATGGAGAGAAGAAGCCGTTTATTCGTAATGTCTTT
TGCTTGGACACGACAAGCTCTATTGTGGCCACACAGGTGCTCGAGTTCGAACAAGAAGAAAAGATGCTGAGTGCA
TGGCAGCAGTTCTTGCTCAAAGTTGACCCCGACATCATTATTGGCTACAACATCTCCAACTTTGACTTTCCGTAT
CTGCTAGACCGAGCAAAGCACCTTAAGGTCAACGGATTCGAATACTGGTCCCGTATTCCGAGTGTACCGTCAAAG
GTCAGAGATACAAATTTCTCAAGTAAACAGATAGGCAATCGTGACACGAAGGAAACCAACACGAACGGCAGGTTA
CAGCTCGATCTATTACAACTGGTTCAACGTGACCACCACCTAAGAAGCTATACACTAAACTCGGTCTGCGCGCAC
TTTCTAGGAGAACAAAAAGAAGATGTGCACCACAGCATGATTACAGAACTCTACAATGGAACACCAGAGTCTCGC
AGGCGTCTGGCATTGTACTGTTTAAAGGACGCATATCTGCCGCAAAGGCTTATGGACAAGCTTTCCTGCCTCGAA
AATTATACAGAGATGGCTAGAGTGACGGGTGTGCCTTTCAACTTTTTGCTGTCGCGCGGTCAGCAGATCAAGTTC
ATCAGTCAACTGTTCCGCAAAGCGTTGGAGCAGAAACTCGTCATTCCAAATCTTAAATCGCAAAAATCCGATGAA
CAGTATGAGGGCGCCACCGTTATCGAGCCCACACGTGGCTATTACGACGTCCCTATTGCGACTCTTGATTTTGCT
TCGCTGTACCCAAGTATCATACAAGCACATAACCTCTGTTACACGACGTTACTTGACAAGAAACTCATTGAGCCC
TTTGGCCTGAAAAAGGACGAGGATTACATTGTAACTCCCAATGGCGATCTGTTTGTAACGGCCAAACAGAGAAGA
GGGCTCTTGGCGCAAATCCTCGAGGAACTTTTGACGGCACGCAAACAGGCGAAGCGGGAGCTTGCACAGGAAACT
GACCCTTTCAGAAAAGCAGTGCTAAACGGTCGTCAATTGGCACTCAAGATTAGCGCCAACAGTGTGTACGGGTTG
ACGGGTGCAACAACAGGAAAGCTGCCTTGTCTCGCAATCGCCAGTAGTACCACGAGTTTTGGTCGCCAAATGATT
GAGAAGACGAAGGCCGAGGTGGAAGCGCGGTATAATATCGCCAACGGGTATAGTCACGACGCACAGGTGATTTAC
GGCGACACGGATTCAGTCATGGTCAAGTTTGGCACCAAAGAGTTGGCTGAGGCGATGAAGCTGGGCGAGGAGGCG
GCGCAATACGTGTCGTCAAAGTTTGTCAAGCCCATCAAGCTCGAGTTTGAAAAGGTTTACTTTCCATACCTGCTC
ATCAACAAGAAGCGGTACGCGGGTCTATTCTGGACCAAGACGGAAAAGTACGACAAGATGGACACCAAGGGTATT
GAGACTGTGCGACGAGACAATTGTCTGCTAGTGCAGACAGTGATTGAAAAGGTGCTGAGGATGATACTCATTGAG
CGAGACGTGCAGGGCGCGCAAGACTACGTCAAGGACACGATTGCAGACTTGCTGCAAAACAAGGTGGACATGTCG
AAGCTAGTCATCACCAAGGCCCTGACCAAGGAAGACTACACAGCCAAACAAGCTCATGTGGAGCTTGCGCAGCGT
ATGAAGAAGCGCGACGCGGGCTCAGCTCCAGGACTGGGAGACCGAGTGGCCTATGTCATGGTGAGAGGGGCGGCA
GGAGCCAAGAATTTTGAGAAATCAGAGGATCCCCTCTACGTGTTGGAAAACAATGTGCCGATTGACACCAAGTAC
TATCTCGACAACCAATTGGCGAAGCCACTGGGGCGCATTTTTGAGCCCATCTTGGGGGAATCCAAGGCTCGGCTG
CTGCTGACTGGAGACCACACGCGAACAATATCGGTGGCGGCGCCGACGGTGGGGGGGCTGATGAAGTTTGCGCGC
AAGACACAGACATGCATGGGGTGCAAGAAGCCGCTCCGAGGGGAGCAAGAAAGCGCGGGGGCAGTATGCGGCGAC
TGCGGGCCGCGTGTGGGAGAACTGTATAAGCGGACGCTGGATCGCGTGTCGGAGCTCGAAGTGCGGTTTGGGAGG
CTATGGACGCAGTGCCAGCGGTGTCAGGGCAGCATGCACTGCGAGGTGATTTGCAGCAGCAAGGACTGTCCCATT
TTCTACATGCGCATGAAGGCGAGAAAGGACCTGGAGGATGCGGGCAAGGAGCTGAGTCGGTTTGACGCAGACCAG
GCAGCCATGTGGTGA
Gene >OphauG2|5224
ATGGCCAGTACGCGTCTGCCGCAGAAGCGAGTGCTCGGGGACGTGGGCACTCGCCAGAACATCACCAGTCCCATA
TCGGCCAAGAGACGCAAGCCCGATGTTTTCTCATCGTCCCCCGCCGCACGATTTTCCGGCTCGCAGAGAGATCCG
CGGGCCAAGCTGGGGTCCAGCCAGCCGACCAAGAGCGTCTTCGAGTCCGAAGTGCTCGAGAAGATGAGCCAGGAC
ATCTCGGACTTGAAAAAGAACAATGCCGAAAAAGATCAGAAATGGGAGCGGCCGCCTGTGGTGGAATTTGATTCT
CGACAGGTCAACTTGTGCTTCCAGGCAATAGAGGCTGAAGAGGGTACCCTCCACGACGGAAAGACAACAGTCAAG
CTGTTTGGAGTTACAGATGCGGGCAATTCTGTCATGCTGCACGTTACCGACTTCAAACACTATATATATGTGCCG
GCACCGCCTCTATTTCAGCCTCAAGATACGGTGGCGTTCAAGGCCTATCTCGAGACACAGATTGCTCAACACCAG
CCTGCAATCCATTCGATTACTCTCTGCCCCAGAGAAAGCATTTACGGCTTCCAGGGGAACAAGAAGAGCCATTTT
CTCAAAATTACTGTCAACGATCCCAAATTTATTCCCAAAGTTCGCTCCACCATCGAACATGGCGATGCGGATTGG
AAAGGCATGTGGAAGGCAAGAGAGAGCGGTGTCATGACTTATGACAATATCCAATACGTCTTGCGATTCATGGTG
GACTGCCACGTAAGGTTCTGAAAGGCCATTGTCACAGAGAGCTTCGCTGACAATGTCTAGATCCAAGGCATGTCA
TGGGTAGAGGCGCCAGCAACCAAGTACAGTCTCATCCCCAATAACAGGAGACAGTCAAACTGTCAGATTGAGGCC
GAGGTCAGCTATGGGCACCTAATCGCGCACAAGCCCGACGGCGAATGGGCCAAAATGGCTCCTTTGCGGATTCTC
TCCTTCGACATTGAGTGTGCCGGACGAAAAGGCATATTTCCAGAGGCCAATCACGACCCTGTTATCCAAATAGCC
AACGTGGTGACAAAATATGGAGAGAAGAAGCCGTTTATTCGTAATGTCTTTTGCTTGGACACGACAAGCTCTATT
GTGGCCACACAGGTGCTCGAGTTCGAACAAGAAGAAAAGATGCTGAGTGCATGGCAGCAGTTCTTGCTCAAAGTT
GACCCCGACATCATTATTGGCTACAACATCTCCAACTTTGACTTTCCGTATCTGCTAGACCGAGCAAAGCACCTT
AAGGTCAACGGATTCGAATACTGGTCCCGTATTCCGAGTGTACCGTCAAAGGTCAGAGATACAAATTTCTCAAGT
AAACAGATAGGCAATCGTGACACGAAGGAAACCAACACGAACGGCAGGTTACAGCTCGATCTATTACAACTGGTT
CAACGTGACCACCACCTAAGAAGCTATACACTAAACTCGGTCTGCGCGCACTTTCTAGGAGAACAAAAAGAAGAT
GTGCACCACAGCATGATTACAGAACTCTACAATGGAACACCAGAGTCTCGCAGGCGTCTGGCATTGTACTGTTTA
AAGGACGCATATCTGCCGCAAAGGCTTATGGACAAGCTTTCCTGCCTCGAAAATTATACAGAGATGGCTAGAGTG
ACGGGTGTGCCTTTCAACTTTTTGCTGTCGCGCGGTCAGCAGATCAAGTTCATCAGTCAACTGTTCCGCAAAGCG
TTGGAGCAGAAACTCGTCATTCCAAATCTTAAATCGCAAAAATCCGATGAACAGTATGAGGGCGCCACCGTTATC
GAGCCCACACGTGGCTATTACGACGTCCCTATTGCGACTCTTGATTTTGCTTCGCTGTACCCAAGTATCATACAA
GCACATAACCTCTGTTACACGACGTTACTTGACAAGAAACTCATTGAGCCCTTTGGCCTGAAAAAGGACGAGGAT
TACATTGTAACTCCCAATGGCGATCTGTTTGTAACGGCCAAACAGAGAAGAGGGCTCTTGGCGCAAATCCTCGAG
GAACTTTTGACGGCACGCAAACAGGCGAAGCGGGAGCTTGCACAGGAAACTGACCCTTTCAGAAAAGCAGTGCTA
AACGGTCGTCAATTGGCACTCAAGATTAGCGCCAACAGTGTGTACGGGTTGACGGGTGCAACAACAGGAAAGCTG
CCTTGTCTCGCAATCGCCAGTAGTACCACGAGTTTTGGTCGCCAAATGATTGAGAAGACGAAGGCCGAGGTGGAA
GCGCGGTATAATATCGCCAACGGGTATAGTCACGACGCACAGGTGATTTACGGCGACACGGATTCAGTCATGGTC
AAGTTTGGCACCAAAGAGTTGGCTGAGGCGATGAAGCTGGGCGAGGAGGCGGCGCAATACGTGTCGTCAAAGTTT
GTCAAGCCCATCAAGCTCGAGTTTGAAAAGGTTTACTTTCCATACCTGCTCATCAACAAGAAGCGGTACGCGGGT
CTATTCTGGACCAAGACGGAAAAGTACGACAAGATGGACACCAAGGGTATTGAGACTGTGCGACGAGACAATTGT
CTGCTAGTGCAGACAGTGATTGAAAAGGTGCTGAGGATGATACTCATTGAGCGAGACGTGCAGGGCGCGCAAGAG
TAAGCGACTATATACCGGCTGAGTGAATTTTGGAGGATTTGACTGACACGGAGCAGCTACGTCAAGGACACGATT
GCAGACTTGCTGCAAAACAAGGTGGACATGTCGAAGCTAGTCATCACCAAGGCCCTGACCAAGGAAGACTACACA
GCCAAACAAGCTCATGTGGAGCTTGCGCAGCGTATGAAGAAGCGCGACGCGGGCTCAGCTCCAGGACTGGGAGAC
CGAGTGGCCTATGTCATGGTGAGAGGGGCGGCAGGAGCCAAGAATTTTGAGAAATCAGAGGATCCCCTCTACGTG
TTGGAAAACAATGTGCCGATTGACACCAAGTACTATCTCGACAACCAATTGGCGAAGCCACTGGGGCGCATTTTT
GAGCCCATCTTGGGGGAATCCAAGGCTCGGCTGCTGCTGACTGGAGACCACACGCGAACAATATCGGTGGCGGCG
CCGACGGTGGGGGGGCTGATGAAGTTTGCGCGCAAGACACAGACATGCATGGGGTGCAAGAAGCCGCTCCGAGGG
GAGCAAGAAAGCGCGGGGGCAGTATGCGGCGACTGCGGGCCGCGTGTGGGAGAACTGTATAAGCGGACGCTGGAT
CGCGTGTCGGAGCTCGAAGTGCGGTTTGGGAGGCTATGGACGCAGTGCCAGCGGTGTCAGGGCAGCATGCACTGC
GAGGTGATTTGCAGCAGCAAGGACTGTCCCATTTTCTACATGCGCATGAAGGCGAGAAAGGACCTGGAGGATGCG
GGCAAGGAGCTGAGTCGGTTTGACGCAGACCAGGCAGCCATGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail