Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5222
Gene name
LocationContig_470:542..2273
Strand+
Gene length (bp)1731
Transcript length (bp)1731
Coding sequence length (bp)1731
Protein length (aa) 577

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01841 Transglut_core Transglutaminase-like superfamily 2.8E-11 112 210

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14302|CYK3_SCHPO cytokinesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyk3 PE=1 SV=1 19 576 4.0E-82
sp|Q07533|CYK3_YEAST Cytokinesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYK3 PE=1 SV=1 15 576 3.0E-61
sp|Q8C8H8|KY_MOUSE Kyphoscoliosis peptidase OS=Mus musculus GN=Ky PE=1 SV=1 113 293 3.0E-11
sp|Q8NBH2|KY_HUMAN Kyphoscoliosis peptidase OS=Homo sapiens GN=KY PE=1 SV=2 113 293 2.0E-10

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3051
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5222 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3596
Ophiocordyceps camponoti-floridani Ophcf2|00619
Ophiocordyceps camponoti-rufipedis Ophun1|2972
Ophiocordyceps kimflemingae Ophio5|3111
Ophiocordyceps subramaniannii Hirsu2|5286

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5222
MDDGAREMGLGRGVDWVQVRRDVNRSNSLSRIEKNERRDRCQMMDHPALNPVDELYESIQGDESLQGTPVAEPLN
YQGINLSQVDKNSRFICEPPPMTTAISLATTYICRPYRSEVQRLRAIFTWVSEKISWEEDFEGEIDTRRVIQTRR
GCAEEYAVLVMEMCAAVGLGCEVVRGYLKSPGDVSDLNMVPRSNHWWNAVVVDSEWRIMDCCLASPSNPKRSQYS
SASNNMADPWWFLLRPSQACWTHVPEHHDQQHIVPPVAHEILLNLPCACPAFFRNGIQMVDYNTSAVRINDLEMV
HVKFNVPPDVEIAAEVEARAFSRDADGDLFDNGDVVRKRALAQAEWYNGVKRYTVKALLPGDEGQAILNVYSGKR
GLMHSIKDIPHALAFALPVVHTGENPPYEFVTRHPTPHAQRHDIYVVQPQCQRLALNNTFVFAIRQHPSSPPGEP
QSTLTPASNPGATSPVPFMRPSSAMSQAASSVSGSNPSSTSGTVAGKKPAKLAIQTPGGKILRLMRKEERRGIGV
ASRGLGGGDEQVSDGGTWETIIKCSERGIWRGLVLADRTARWCVFAEWTCV*
Coding >OphauG2|5222
ATGGACGACGGCGCCCGGGAAATGGGCCTTGGCCGCGGGGTCGACTGGGTCCAAGTCCGGCGAGACGTAAACCGA
TCAAATTCGTTGAGCAGGATTGAAAAGAATGAGCGCAGAGACCGGTGCCAGATGATGGACCATCCGGCGCTGAAT
CCCGTCGATGAGCTCTACGAGAGCATCCAAGGGGACGAAAGCCTTCAGGGCACGCCCGTGGCAGAGCCGCTCAAC
TACCAGGGCATCAACCTGAGCCAAGTCGACAAGAACTCACGCTTCATCTGCGAGCCTCCGCCAATGACAACGGCC
ATATCACTGGCCACAACGTATATTTGCAGGCCGTACCGCAGCGAGGTGCAGCGTCTCCGCGCCATCTTCACGTGG
GTGTCGGAAAAGATAAGCTGGGAGGAAGATTTTGAAGGCGAAATCGACACGCGGCGCGTCATCCAGACACGGCGC
GGCTGTGCCGAGGAATACGCAGTCCTCGTCATGGAAATGTGTGCGGCCGTCGGACTCGGCTGTGAGGTGGTGCGA
GGATATCTCAAGAGCCCAGGCGACGTGTCCGACTTGAACATGGTGCCGCGTTCCAACCACTGGTGGAACGCAGTC
GTCGTGGACAGCGAATGGCGCATCATGGACTGCTGTCTGGCCAGCCCGTCGAATCCCAAGCGCAGCCAGTATTCG
AGTGCCAGCAACAACATGGCCGACCCCTGGTGGTTTCTCCTGCGCCCAAGCCAAGCTTGCTGGACACATGTGCCC
GAGCATCATGACCAGCAGCACATTGTGCCTCCAGTGGCACATGAGATCCTGCTCAACCTGCCATGCGCCTGTCCT
GCCTTTTTCCGCAACGGCATCCAAATGGTGGACTACAACACGTCGGCCGTGAGGATCAACGACTTGGAAATGGTA
CACGTCAAGTTCAATGTGCCGCCCGACGTGGAGATTGCGGCCGAGGTGGAGGCGCGTGCCTTTTCGAGGGATGCG
GATGGCGACTTGTTTGACAATGGCGACGTGGTGAGGAAGCGAGCGCTGGCACAGGCCGAGTGGTATAATGGCGTC
AAGCGCTATACAGTAAAGGCGCTGTTGCCGGGCGACGAGGGCCAGGCAATTCTCAACGTGTACTCTGGGAAACGC
GGCCTGATGCACAGCATCAAGGATATTCCCCACGCACTGGCCTTTGCTCTGCCAGTTGTACATACGGGCGAGAAT
CCGCCCTACGAGTTTGTCACGCGACATCCGACGCCTCATGCCCAACGCCACGACATTTACGTGGTGCAGCCCCAG
TGCCAGCGACTGGCCCTCAACAACACCTTTGTCTTTGCCATTCGCCAGCACCCCAGCTCGCCCCCAGGCGAGCCC
CAATCAACGCTGACGCCTGCCTCCAACCCGGGTGCTACGAGCCCTGTTCCCTTTATGAGACCAAGCTCCGCCATG
AGCCAGGCGGCATCAAGCGTCAGCGGCTCCAACCCCAGCTCCACCAGTGGAACAGTGGCAGGCAAAAAACCAGCC
AAGCTGGCCATTCAGACCCCTGGCGGCAAGATTCTCCGTCTTATGAGGAAGGAGGAACGCCGCGGCATTGGCGTC
GCCAGCAGGGGGCTAGGAGGAGGCGACGAGCAGGTCAGTGATGGCGGCACCTGGGAAACGATTATCAAGTGCTCC
GAGCGGGGCATATGGCGAGGCCTGGTGCTGGCTGACCGCACCGCCCGCTGGTGTGTCTTTGCAGAATGGACATGC
GTGTGA
Transcript >OphauG2|5222
ATGGACGACGGCGCCCGGGAAATGGGCCTTGGCCGCGGGGTCGACTGGGTCCAAGTCCGGCGAGACGTAAACCGA
TCAAATTCGTTGAGCAGGATTGAAAAGAATGAGCGCAGAGACCGGTGCCAGATGATGGACCATCCGGCGCTGAAT
CCCGTCGATGAGCTCTACGAGAGCATCCAAGGGGACGAAAGCCTTCAGGGCACGCCCGTGGCAGAGCCGCTCAAC
TACCAGGGCATCAACCTGAGCCAAGTCGACAAGAACTCACGCTTCATCTGCGAGCCTCCGCCAATGACAACGGCC
ATATCACTGGCCACAACGTATATTTGCAGGCCGTACCGCAGCGAGGTGCAGCGTCTCCGCGCCATCTTCACGTGG
GTGTCGGAAAAGATAAGCTGGGAGGAAGATTTTGAAGGCGAAATCGACACGCGGCGCGTCATCCAGACACGGCGC
GGCTGTGCCGAGGAATACGCAGTCCTCGTCATGGAAATGTGTGCGGCCGTCGGACTCGGCTGTGAGGTGGTGCGA
GGATATCTCAAGAGCCCAGGCGACGTGTCCGACTTGAACATGGTGCCGCGTTCCAACCACTGGTGGAACGCAGTC
GTCGTGGACAGCGAATGGCGCATCATGGACTGCTGTCTGGCCAGCCCGTCGAATCCCAAGCGCAGCCAGTATTCG
AGTGCCAGCAACAACATGGCCGACCCCTGGTGGTTTCTCCTGCGCCCAAGCCAAGCTTGCTGGACACATGTGCCC
GAGCATCATGACCAGCAGCACATTGTGCCTCCAGTGGCACATGAGATCCTGCTCAACCTGCCATGCGCCTGTCCT
GCCTTTTTCCGCAACGGCATCCAAATGGTGGACTACAACACGTCGGCCGTGAGGATCAACGACTTGGAAATGGTA
CACGTCAAGTTCAATGTGCCGCCCGACGTGGAGATTGCGGCCGAGGTGGAGGCGCGTGCCTTTTCGAGGGATGCG
GATGGCGACTTGTTTGACAATGGCGACGTGGTGAGGAAGCGAGCGCTGGCACAGGCCGAGTGGTATAATGGCGTC
AAGCGCTATACAGTAAAGGCGCTGTTGCCGGGCGACGAGGGCCAGGCAATTCTCAACGTGTACTCTGGGAAACGC
GGCCTGATGCACAGCATCAAGGATATTCCCCACGCACTGGCCTTTGCTCTGCCAGTTGTACATACGGGCGAGAAT
CCGCCCTACGAGTTTGTCACGCGACATCCGACGCCTCATGCCCAACGCCACGACATTTACGTGGTGCAGCCCCAG
TGCCAGCGACTGGCCCTCAACAACACCTTTGTCTTTGCCATTCGCCAGCACCCCAGCTCGCCCCCAGGCGAGCCC
CAATCAACGCTGACGCCTGCCTCCAACCCGGGTGCTACGAGCCCTGTTCCCTTTATGAGACCAAGCTCCGCCATG
AGCCAGGCGGCATCAAGCGTCAGCGGCTCCAACCCCAGCTCCACCAGTGGAACAGTGGCAGGCAAAAAACCAGCC
AAGCTGGCCATTCAGACCCCTGGCGGCAAGATTCTCCGTCTTATGAGGAAGGAGGAACGCCGCGGCATTGGCGTC
GCCAGCAGGGGGCTAGGAGGAGGCGACGAGCAGGTCAGTGATGGCGGCACCTGGGAAACGATTATCAAGTGCTCC
GAGCGGGGCATATGGCGAGGCCTGGTGCTGGCTGACCGCACCGCCCGCTGGTGTGTCTTTGCAGAATGGACATGC
GTGTGA
Gene >OphauG2|5222
ATGGACGACGGCGCCCGGGAAATGGGCCTTGGCCGCGGGGTCGACTGGGTCCAAGTCCGGCGAGACGTAAACCGA
TCAAATTCGTTGAGCAGGATTGAAAAGAATGAGCGCAGAGACCGGTGCCAGATGATGGACCATCCGGCGCTGAAT
CCCGTCGATGAGCTCTACGAGAGCATCCAAGGGGACGAAAGCCTTCAGGGCACGCCCGTGGCAGAGCCGCTCAAC
TACCAGGGCATCAACCTGAGCCAAGTCGACAAGAACTCACGCTTCATCTGCGAGCCTCCGCCAATGACAACGGCC
ATATCACTGGCCACAACGTATATTTGCAGGCCGTACCGCAGCGAGGTGCAGCGTCTCCGCGCCATCTTCACGTGG
GTGTCGGAAAAGATAAGCTGGGAGGAAGATTTTGAAGGCGAAATCGACACGCGGCGCGTCATCCAGACACGGCGC
GGCTGTGCCGAGGAATACGCAGTCCTCGTCATGGAAATGTGTGCGGCCGTCGGACTCGGCTGTGAGGTGGTGCGA
GGATATCTCAAGAGCCCAGGCGACGTGTCCGACTTGAACATGGTGCCGCGTTCCAACCACTGGTGGAACGCAGTC
GTCGTGGACAGCGAATGGCGCATCATGGACTGCTGTCTGGCCAGCCCGTCGAATCCCAAGCGCAGCCAGTATTCG
AGTGCCAGCAACAACATGGCCGACCCCTGGTGGTTTCTCCTGCGCCCAAGCCAAGCTTGCTGGACACATGTGCCC
GAGCATCATGACCAGCAGCACATTGTGCCTCCAGTGGCACATGAGATCCTGCTCAACCTGCCATGCGCCTGTCCT
GCCTTTTTCCGCAACGGCATCCAAATGGTGGACTACAACACGTCGGCCGTGAGGATCAACGACTTGGAAATGGTA
CACGTCAAGTTCAATGTGCCGCCCGACGTGGAGATTGCGGCCGAGGTGGAGGCGCGTGCCTTTTCGAGGGATGCG
GATGGCGACTTGTTTGACAATGGCGACGTGGTGAGGAAGCGAGCGCTGGCACAGGCCGAGTGGTATAATGGCGTC
AAGCGCTATACAGTAAAGGCGCTGTTGCCGGGCGACGAGGGCCAGGCAATTCTCAACGTGTACTCTGGGAAACGC
GGCCTGATGCACAGCATCAAGGATATTCCCCACGCACTGGCCTTTGCTCTGCCAGTTGTACATACGGGCGAGAAT
CCGCCCTACGAGTTTGTCACGCGACATCCGACGCCTCATGCCCAACGCCACGACATTTACGTGGTGCAGCCCCAG
TGCCAGCGACTGGCCCTCAACAACACCTTTGTCTTTGCCATTCGCCAGCACCCCAGCTCGCCCCCAGGCGAGCCC
CAATCAACGCTGACGCCTGCCTCCAACCCGGGTGCTACGAGCCCTGTTCCCTTTATGAGACCAAGCTCCGCCATG
AGCCAGGCGGCATCAAGCGTCAGCGGCTCCAACCCCAGCTCCACCAGTGGAACAGTGGCAGGCAAAAAACCAGCC
AAGCTGGCCATTCAGACCCCTGGCGGCAAGATTCTCCGTCTTATGAGGAAGGAGGAACGCCGCGGCATTGGCGTC
GCCAGCAGGGGGCTAGGAGGAGGCGACGAGCAGGTCAGTGATGGCGGCACCTGGGAAACGATTATCAAGTGCTCC
GAGCGGGGCATATGGCGAGGCCTGGTGCTGGCTGACCGCACCGCCCGCTGGTGTGTCTTTGCAGAATGGACATGC
GTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail