Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5219
Gene name
LocationContig_47:32751..35342
Strand-
Gene length (bp)2591
Transcript length (bp)2460
Coding sequence length (bp)2460
Protein length (aa) 820

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07792 Afi1 Docking domain of Afi1 for Arf3 in vesicle trafficking 1.6E-41 106 238
PF08616 SPA Stabilization of polarity axis 2.8E-36 432 541

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5BGR2|MESA_EMENI Protein mesA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mesA PE=1 SV=2 54 810 0.0E+00
sp|O94674|YG76_SCHPO AFI1-like protein C776.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC776.06c PE=3 SV=2 103 786 7.0E-83
sp|Q99222|AFI1_YEAST ARF3-interacting protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFI1 PE=1 SV=1 103 294 6.0E-14

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3071
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5219 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6899
Ophiocordyceps camponoti-floridani Ophcf2|07110
Ophiocordyceps camponoti-rufipedis Ophun1|6458
Ophiocordyceps kimflemingae Ophio5|6759
Ophiocordyceps subramaniannii Hirsu2|533

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5219
MATALPSVPQQYGISQRSAANGPAAPLSHRRTSLSSLPRSRSSSNMSTRDTDRSSDPSSKSKTPSLEPSSQHSSL
LAPRRGNALLHSSRKLRSQYPQGSGEQHVGYILVASFDIDRGPVMEHQYPDAISGDENMLAELMLPDQAHARKQD
WTIFFLHKDNDDDDKEKRRRQRRRRRHSNDGDDENADNLDQDYNSQDGGKDDDDDDDDDWSDSEMDGNQAAPLVH
VLNLVNTKHDKSVKRGAVVKAMAICTRHPFLHIYKPLLLLALEEYFKSPKIETLAMLYTAVNAMDLSLMPRLGYL
ERHLLLGSDNKDLFVEKFEQMIQMRMAKDKAEDGINTPATAVMEGHGSPATKMAGISRAGTKAHVEGGSQSIYSV
PRDTHEFETKVLYKGIPIPIKVPTAVMAETVGDFSLIKLIQNFSEPHAKSPQPFPLHPHLTTNGANTHPFIVLVN
ALLTQKRIVFLGHNMPSGEVAEAVLAACSLASGGVLRGFTRHAFPYTDLTKIDNLLTVPGFIAGVTNPTFEHHPE
WWDIMCDLPTGRIKISSKIEPMPMTEGLIYFQQQNQSLAGVAGGNQSGSHDMTGDAAFMADILRSISARHGERVI
RAKWRDWVVRFTRIAAQFEESVYGASALYVGGDELEMALPGASGHGYVWPDDASKNKELAGNVTRIEGWRNTRSY
YTYIKDLARMYAVKPLKGLDLAHIHDRLRLQRLTAAQSRDIYLTLARHVHSYDDICLLLNVSPEAHAGLFYLALG
LFHKEREVRLRTAELLERVAEHEAGQHWWKSLSRFEKLAFARLRREADAETRTKSDKEGPSPVIEQRLS*
Coding >OphauG2|5219
ATGGCGACGGCTCTCCCCTCGGTGCCGCAACAGTACGGCATCAGCCAGCGCAGCGCCGCCAACGGGCCAGCGGCT
CCATTGAGCCATCGCCGCACCTCGCTCTCTTCACTCCCTCGCTCCCGCTCCTCGTCCAACATGTCGACGCGCGAT
ACGGACCGGAGCTCCGACCCCAGCTCCAAGTCCAAGACCCCCTCGCTGGAGCCCTCGTCCCAGCACTCGTCCCTG
TTGGCCCCCCGACGAGGAAACGCCCTCTTGCACTCGTCGCGGAAGCTGCGCTCGCAGTATCCCCAGGGCTCGGGC
GAGCAGCATGTGGGCTACATTCTCGTGGCCTCGTTTGATATCGACCGAGGCCCTGTCATGGAGCACCAGTACCCT
GATGCTATCAGCGGAGACGAAAACATGCTGGCCGAACTCATGCTGCCCGATCAAGCACATGCCCGCAAGCAGGAC
TGGACCATCTTCTTCTTACACAAAGACAACGACGATGACGACAAGGAAAAGAGACGGCGCCAGCGGAGGCGGAGA
CGGCACTCCAACGACGGCGACGACGAAAATGCCGACAACCTTGACCAAGACTACAACAGCCAAGATGGCGGCAAG
GACGACGACGACGACGACGACGACGACTGGTCAGATAGTGAGATGGATGGCAATCAGGCCGCGCCCTTGGTTCAC
GTGCTCAACCTGGTCAACACCAAGCACGACAAGTCTGTCAAGAGAGGGGCCGTGGTCAAAGCGATGGCTATTTGC
ACCCGGCATCCGTTTTTGCATATATACAAGCCGCTGCTGCTCTTGGCGCTCGAGGAGTACTTCAAGTCGCCCAAG
ATTGAGACGCTGGCCATGCTCTATACGGCCGTCAACGCAATGGACCTATCACTGATGCCCCGACTAGGCTACCTC
GAGAGACACTTGCTGCTGGGCAGCGACAATAAGGACCTGTTTGTGGAGAAATTTGAGCAAATGATTCAGATGCGC
ATGGCCAAGGACAAGGCAGAGGATGGCATCAATACCCCCGCCACGGCTGTCATGGAGGGACACGGCAGCCCGGCA
ACCAAGATGGCAGGCATCTCTCGGGCCGGCACCAAGGCCCACGTCGAGGGCGGCAGCCAGTCCATCTACTCGGTG
CCTCGCGACACACACGAGTTTGAGACCAAGGTGCTGTACAAGGGCATCCCCATCCCCATCAAGGTGCCGACGGCC
GTCATGGCGGAAACGGTTGGCGACTTTTCCCTCATCAAGCTGATTCAGAATTTCTCCGAGCCGCACGCCAAGTCG
CCACAGCCCTTTCCACTGCATCCCCATCTCACCACCAATGGCGCCAATACACACCCCTTTATCGTTCTCGTCAAT
GCACTGCTGACGCAAAAGAGAATTGTTTTTCTCGGCCACAACATGCCGTCGGGCGAAGTGGCCGAAGCAGTCTTG
GCCGCCTGCTCGCTTGCCTCGGGCGGCGTGCTGCGCGGCTTCACTCGCCACGCCTTTCCCTACACCGACCTGACC
AAGATTGACAACCTGCTCACGGTGCCGGGCTTCATCGCCGGCGTCACGAATCCAACATTTGAGCATCATCCCGAG
TGGTGGGACATTATGTGCGATCTGCCGACGGGGCGCATCAAGATTAGCAGCAAGATTGAGCCAATGCCCATGACT
GAAGGCCTCATCTACTTCCAGCAGCAGAATCAGTCGCTGGCTGGCGTGGCTGGCGGCAACCAGAGCGGCAGCCAC
GACATGACGGGAGACGCAGCCTTCATGGCGGATATTTTGCGCAGCATCTCGGCGCGGCATGGCGAGCGCGTCATT
CGAGCCAAGTGGCGCGACTGGGTCGTCCGCTTCACGCGCATCGCGGCACAGTTTGAGGAGAGTGTCTATGGAGCG
AGTGCTCTCTACGTTGGCGGTGACGAGCTTGAAATGGCACTGCCGGGAGCCAGTGGCCATGGCTACGTTTGGCCT
GACGACGCGTCCAAGAACAAGGAACTGGCTGGAAACGTGACAAGAATAGAAGGCTGGCGTAACACGCGCAGCTAC
TATACCTATATCAAGGACCTGGCAAGAATGTACGCTGTCAAGCCGCTCAAGGGACTTGATTTGGCTCACATTCAC
GACCGGCTGCGTCTACAGCGGCTCACGGCAGCCCAGAGCCGCGACATTTACCTCACGCTGGCGCGGCACGTGCAC
TCGTACGACGATATTTGCCTGCTGCTCAACGTGTCACCCGAGGCTCACGCAGGGCTCTTTTACCTGGCGCTGGGC
CTCTTCCACAAGGAACGCGAAGTGCGCCTGCGCACGGCAGAGCTGCTGGAGCGTGTGGCAGAGCACGAGGCTGGA
CAGCACTGGTGGAAGAGCCTGAGTCGCTTTGAAAAGCTGGCGTTTGCCCGGCTGCGGCGCGAGGCAGATGCCGAG
ACGAGGACCAAGTCGGACAAGGAGGGACCGAGCCCCGTAATCGAGCAGCGTCTCAGCTGA
Transcript >OphauG2|5219
ATGGCGACGGCTCTCCCCTCGGTGCCGCAACAGTACGGCATCAGCCAGCGCAGCGCCGCCAACGGGCCAGCGGCT
CCATTGAGCCATCGCCGCACCTCGCTCTCTTCACTCCCTCGCTCCCGCTCCTCGTCCAACATGTCGACGCGCGAT
ACGGACCGGAGCTCCGACCCCAGCTCCAAGTCCAAGACCCCCTCGCTGGAGCCCTCGTCCCAGCACTCGTCCCTG
TTGGCCCCCCGACGAGGAAACGCCCTCTTGCACTCGTCGCGGAAGCTGCGCTCGCAGTATCCCCAGGGCTCGGGC
GAGCAGCATGTGGGCTACATTCTCGTGGCCTCGTTTGATATCGACCGAGGCCCTGTCATGGAGCACCAGTACCCT
GATGCTATCAGCGGAGACGAAAACATGCTGGCCGAACTCATGCTGCCCGATCAAGCACATGCCCGCAAGCAGGAC
TGGACCATCTTCTTCTTACACAAAGACAACGACGATGACGACAAGGAAAAGAGACGGCGCCAGCGGAGGCGGAGA
CGGCACTCCAACGACGGCGACGACGAAAATGCCGACAACCTTGACCAAGACTACAACAGCCAAGATGGCGGCAAG
GACGACGACGACGACGACGACGACGACTGGTCAGATAGTGAGATGGATGGCAATCAGGCCGCGCCCTTGGTTCAC
GTGCTCAACCTGGTCAACACCAAGCACGACAAGTCTGTCAAGAGAGGGGCCGTGGTCAAAGCGATGGCTATTTGC
ACCCGGCATCCGTTTTTGCATATATACAAGCCGCTGCTGCTCTTGGCGCTCGAGGAGTACTTCAAGTCGCCCAAG
ATTGAGACGCTGGCCATGCTCTATACGGCCGTCAACGCAATGGACCTATCACTGATGCCCCGACTAGGCTACCTC
GAGAGACACTTGCTGCTGGGCAGCGACAATAAGGACCTGTTTGTGGAGAAATTTGAGCAAATGATTCAGATGCGC
ATGGCCAAGGACAAGGCAGAGGATGGCATCAATACCCCCGCCACGGCTGTCATGGAGGGACACGGCAGCCCGGCA
ACCAAGATGGCAGGCATCTCTCGGGCCGGCACCAAGGCCCACGTCGAGGGCGGCAGCCAGTCCATCTACTCGGTG
CCTCGCGACACACACGAGTTTGAGACCAAGGTGCTGTACAAGGGCATCCCCATCCCCATCAAGGTGCCGACGGCC
GTCATGGCGGAAACGGTTGGCGACTTTTCCCTCATCAAGCTGATTCAGAATTTCTCCGAGCCGCACGCCAAGTCG
CCACAGCCCTTTCCACTGCATCCCCATCTCACCACCAATGGCGCCAATACACACCCCTTTATCGTTCTCGTCAAT
GCACTGCTGACGCAAAAGAGAATTGTTTTTCTCGGCCACAACATGCCGTCGGGCGAAGTGGCCGAAGCAGTCTTG
GCCGCCTGCTCGCTTGCCTCGGGCGGCGTGCTGCGCGGCTTCACTCGCCACGCCTTTCCCTACACCGACCTGACC
AAGATTGACAACCTGCTCACGGTGCCGGGCTTCATCGCCGGCGTCACGAATCCAACATTTGAGCATCATCCCGAG
TGGTGGGACATTATGTGCGATCTGCCGACGGGGCGCATCAAGATTAGCAGCAAGATTGAGCCAATGCCCATGACT
GAAGGCCTCATCTACTTCCAGCAGCAGAATCAGTCGCTGGCTGGCGTGGCTGGCGGCAACCAGAGCGGCAGCCAC
GACATGACGGGAGACGCAGCCTTCATGGCGGATATTTTGCGCAGCATCTCGGCGCGGCATGGCGAGCGCGTCATT
CGAGCCAAGTGGCGCGACTGGGTCGTCCGCTTCACGCGCATCGCGGCACAGTTTGAGGAGAGTGTCTATGGAGCG
AGTGCTCTCTACGTTGGCGGTGACGAGCTTGAAATGGCACTGCCGGGAGCCAGTGGCCATGGCTACGTTTGGCCT
GACGACGCGTCCAAGAACAAGGAACTGGCTGGAAACGTGACAAGAATAGAAGGCTGGCGTAACACGCGCAGCTAC
TATACCTATATCAAGGACCTGGCAAGAATGTACGCTGTCAAGCCGCTCAAGGGACTTGATTTGGCTCACATTCAC
GACCGGCTGCGTCTACAGCGGCTCACGGCAGCCCAGAGCCGCGACATTTACCTCACGCTGGCGCGGCACGTGCAC
TCGTACGACGATATTTGCCTGCTGCTCAACGTGTCACCCGAGGCTCACGCAGGGCTCTTTTACCTGGCGCTGGGC
CTCTTCCACAAGGAACGCGAAGTGCGCCTGCGCACGGCAGAGCTGCTGGAGCGTGTGGCAGAGCACGAGGCTGGA
CAGCACTGGTGGAAGAGCCTGAGTCGCTTTGAAAAGCTGGCGTTTGCCCGGCTGCGGCGCGAGGCAGATGCCGAG
ACGAGGACCAAGTCGGACAAGGAGGGACCGAGCCCCGTAATCGAGCAGCGTCTCAGCTGA
Gene >OphauG2|5219
ATGGCGACGGCTCTCCCCTCGGTGCCGCAACAGTACGGCATCAGCCAGCGCAGCGCCGCCAACGGGCCAGCGGCT
CCATTGAGCCATCGCCGCACCTCGCTCTCTTCACTCCCTCGCTCCCGCTCCTCGTCCAACATGTCGACGCGCGAT
ACGGACCGGAGCTCCGACCCCAGCTCCAAGTCCAAGACCCCCTCGCTGGAGCCCTCGTCCCAGCACTCGTCCCTG
TTGGCCCCCCGACGAGGAAACGCCCTCTTGCACTCGTCGCGGAAGCTGCGCTCGCAGTATCCCCAGGGCTCGGGC
GAGCAGCATGTGGGCTACATTCTCGTGGCCTCGTTTGATATCGACCGAGGCCCTGTCATGGAGCACCAGTACCCT
GATGCTATCAGCGGAGACGAAAACATGCTGGCCGAACTCATGCTGCCCGATCAAGCACATGCCCGCAAGCAGGAC
TGGACCATCTTCTTCTTACACAAAGACAACGACGATGACGACAAGGAAAAGAGACGGCGCCAGCGGAGGCGGAGA
CGGCACTCCAACGACGGCGACGACGAAAATGCCGACAACCTTGACCAAGACTACAACAGCCAAGATGGCGGCAAG
GACGACGACGACGACGACGACGACGACTGGTCAGATAGTGAGATGGATGGCAATCAGGCCGCGCCCTTGGTTCAC
GTGCTCAACCTGGTCAACACCAAGCACGACAAGTCTGTCAAGAGAGGGGCCGTGGTCAAAGCGATGGCTATTTGC
ACCCGGCATCCGTTTTTGCATATATACAAGGTGAGAGGGAGGCCTCTATCAAGATTTGCTGAATTGCTTGCTGAC
GCTAGGGACCAGCCGCTGCTGCTCTTGGCGCTCGAGGAGTACTTCAAGTCGCCCAAGATTGAGACGCTGGCCATG
CTCTATACGGCCGTCAACGCAATGGACCTATCACTGATGCCCCGACTAGGCTACCTCGAGAGACACTTGCTGCTG
GGCAGCGACAATAAGGACCTGTTTGTGGAGAAATTTGAGCAAATGATTCAGATGCGCATGGCCAAGGACAAGGCA
GAGGATGGCATCAATACCCCCGCCACGGCTGTCATGGAGGGACACGGCAGCCCGGCAACCAAGATGGCAGGCATC
TCTCGGGCCGGCACCAAGGCCCACGTCGAGGGCGGCAGCCAGTCCATCTACTCGGTGCCTCGCGACACACACGAG
TTTGAGACCAAGGTGCTGTACAAGGGCATCCCCATCCCCATCAAGGTGCCGACGGCCGTCATGGCGGAAACGGTT
GGCGACTTTTCCCTCATCAAGCTGATTCAGAATTTCTCCGAGCCGCACGCCAAGTCGCCACAGCCCTTTCCACTG
CATCCCCATCTCACCACCAATGGCGCCAATACACACCCCTTTATCGTTCTCGTCAATGCACTGCTGACGCAAAAG
AGAATTGTTTTTCTCGGCCACAACATGCCGTCGGGCGAAGTGGCCGAAGCAGTCTTGGCCGCCTGCTCGCTTGCC
TCGGGCGGCGTGCTGCGCGGCTTCACTCGCCACGCCTTTCCCTACACCGACCTGACCAAGATTGACAACCTGCTC
ACGGTGCCGGGCTTCATCGCCGGCGTCACGAATCCAACATTTGAGCATCATCCCGAGTGGTGGGACATTATGTGC
GATCTGCCGACGGGGCGCATCAAGATTAGCAGCAAGATTGAGCCAATGCCCATGACTGAAGGCCTCATCTACTTC
CAGCAGCAGAATCAGTCGCTGGCTGGCGTGGCTGGCGGCAACCAGAGCGGCAGCCACGACATGACGGGAGACGCA
GCCTTCATGGCGGATATTTTGCGCAGCATCTCGGCGCGGCATGGCGAGCGCGTCATTCGAGCCAAGTGGCGCGAC
TGGGTCGTCCGCTTCACGCGCATCGCGGCACAGTTTGAGGAGAGTGTCTATGGAGCGAGTGCTCTCTACGTTGGC
GGTGACGAGCTTGAAATGGCACTGCCGGGAGCCAGTGGCCATGGCTACGTTTGGCCTGACGACGCGTCCAAGAAC
AAGGAACTGGCTGGAAACGTGACAAGAATAGAAGGCTGGCGTAACACGCGCAGCTACTATACCTATATCAAGGTG
AGATGAAAAGAGGACAAGACAAGAAAAACAAGATACTCGAGACTCTGTTGGCTAACAAGTCGTTTTGCCAGGACC
TGGCAAGAATGTACGCTGTCAAGCCGCTCAAGGGACTTGATTTGGCTCACATTCACGACCGGCTGCGTCTACAGC
GGCTCACGGCAGCCCAGAGCCGCGACATTTACCTCACGCTGGCGCGGCACGTGCACTCGTACGACGATATTTGCC
TGCTGCTCAACGTGTCACCCGAGGCTCACGCAGGGCTCTTTTACCTGGCGCTGGGCCTCTTCCACAAGGAACGCG
AAGTGCGCCTGCGCACGGCAGAGCTGCTGGAGCGTGTGGCAGAGCACGAGGCTGGACAGCACTGGTGGAAGAGCC
TGAGTCGCTTTGAAAAGCTGGCGTTTGCCCGGCTGCGGCGCGAGGCAGATGCCGAGACGAGGACCAAGTCGGACA
AGGAGGGACCGAGCCCCGTAATCGAGCAGCGTCTCAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail