Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5216
Gene name
LocationContig_47:28406..29062
Strand+
Gene length (bp)656
Transcript length (bp)474
Coding sequence length (bp)474
Protein length (aa) 158

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6 3.1E-13 85 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P20435|RPAB2_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO26 PE=1 SV=1 71 156 4.0E-43
sp|P36595|RPAB2_SCHPO DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb6 PE=1 SV=1 41 156 1.0E-42
sp|Q54FA8|RPAB2_DICDI DNA-directed RNA polymerases I, II, and III subunit rpabc2 OS=Dictyostelium discoideum GN=polr2f PE=3 SV=1 58 155 5.0E-38
sp|A8WSV7|RPAB2_CAEBR Probable DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Caenorhabditis briggsae GN=rpb-6 PE=3 SV=1 76 155 1.0E-35
sp|Q17684|RPAB2_CAEEL Probable DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Caenorhabditis elegans GN=rpb-6 PE=3 SV=1 76 155 5.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P20435|RPAB2_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO26 PE=1 SV=1 71 156 4.0E-43
sp|P36595|RPAB2_SCHPO DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb6 PE=1 SV=1 41 156 1.0E-42
sp|Q54FA8|RPAB2_DICDI DNA-directed RNA polymerases I, II, and III subunit rpabc2 OS=Dictyostelium discoideum GN=polr2f PE=3 SV=1 58 155 5.0E-38
sp|A8WSV7|RPAB2_CAEBR Probable DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Caenorhabditis briggsae GN=rpb-6 PE=3 SV=1 76 155 1.0E-35
sp|Q17684|RPAB2_CAEEL Probable DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Caenorhabditis elegans GN=rpb-6 PE=3 SV=1 76 155 5.0E-35
sp|O88828|RPAB2_RAT DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Rattus norvegicus GN=Polr2f PE=1 SV=1 81 156 6.0E-35
sp|P61219|RPAB2_MOUSE DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Mus musculus GN=Polr2f PE=2 SV=1 81 156 6.0E-35
sp|Q32PE0|RPAB2_BOVIN DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Bos taurus GN=POLR2F PE=2 SV=1 81 156 7.0E-35
sp|Q5R592|RPAB2_PONAB DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Pongo abelii GN=POLR2F PE=2 SV=1 81 156 7.0E-35
sp|P61218|RPAB2_HUMAN DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Homo sapiens GN=POLR2F PE=1 SV=1 81 156 7.0E-35
sp|P61217|RPAB2_CRIGR DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Cricetulus griseus GN=POLR2F PE=2 SV=1 81 156 7.0E-35
sp|Q24320|RPAB2_DROME DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Drosophila melanogaster GN=RpII18 PE=2 SV=1 78 156 8.0E-35
sp|Q9FJ98|RPD6A_ARATH DNA-directed RNA polymerases II, IV and V subunit 6A OS=Arabidopsis thaliana GN=NRPB6A PE=1 SV=1 46 156 7.0E-33
sp|Q9SJ96|RPB6B_ARATH DNA-directed RNA polymerases II and V subunit 6B OS=Arabidopsis thaliana GN=NRPB6B PE=1 SV=1 83 156 6.0E-32
sp|Q5UQ32|RPO6_MIMIV DNA-directed RNA polymerase subunit 6 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R209 PE=3 SV=1 73 155 2.0E-14
sp|A1RWX0|RPOK_THEPD DNA-directed RNA polymerase subunit K OS=Thermofilum pendens (strain Hrk 5) GN=rpoK PE=3 SV=1 87 149 1.0E-13
sp|Q8TT40|RPOK_METAC DNA-directed RNA polymerase subunit K OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpoK PE=3 SV=1 90 140 1.0E-12
sp|Q9YDJ9|RPOK_AERPE DNA-directed RNA polymerase subunit K OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpoK PE=3 SV=2 87 157 2.0E-12
sp|Q8PW42|RPOK_METMA DNA-directed RNA polymerase subunit K OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpoK PE=3 SV=1 90 140 4.0E-12
sp|Q8ZTF9|RPOK_PYRAE DNA-directed RNA polymerase subunit K OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpoK PE=3 SV=1 87 157 6.0E-12
sp|A2SSV2|RPOK_METLZ DNA-directed RNA polymerase subunit K OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpoK PE=3 SV=1 90 156 2.0E-10
sp|A0B6E6|RPOK_METTP DNA-directed RNA polymerase subunit K OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpoK PE=3 SV=1 90 140 2.0E-09
sp|C5A244|RPOK_THEGJ DNA-directed RNA polymerase subunit K OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpoK PE=3 SV=1 90 140 3.0E-09
sp|B0R4Y7|RPOK_HALS3 DNA-directed RNA polymerase subunit K OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoK PE=3 SV=1 88 140 3.0E-09
sp|Q9HQJ0|RPOK_HALSA DNA-directed RNA polymerase subunit K OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoK PE=3 SV=1 88 140 3.0E-09
sp|O26148|RPOK_METTH DNA-directed RNA polymerase subunit K OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoK PE=3 SV=1 89 140 3.0E-09
sp|O29134|RPOK_ARCFU DNA-directed RNA polymerase subunit K OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpoK PE=3 SV=1 90 140 4.0E-09
sp|Q8U0E8|RPOK_PYRFU DNA-directed RNA polymerase subunit K OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpoK PE=3 SV=1 90 140 6.0E-09
sp|B9LPW5|RPOK_HALLT DNA-directed RNA polymerase subunit K OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpoK PE=3 SV=1 91 140 7.0E-09
sp|Q97ZJ9|RPOK_SULSO DNA-directed RNA polymerase subunit K OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoK PE=1 SV=1 89 145 8.0E-09
sp|P62015|RPOK_PYRHO DNA-directed RNA polymerase subunit K OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpoK PE=3 SV=1 90 140 2.0E-08
sp|P62014|RPOK_PYRAB DNA-directed RNA polymerase subunit K OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpoK PE=3 SV=1 90 140 2.0E-08
sp|Q5JJD0|RPOK_THEKO DNA-directed RNA polymerase subunit K OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpoK PE=1 SV=1 90 140 3.0E-08
sp|P58232|RPOK_THEVO DNA-directed RNA polymerase subunit K OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpoK PE=3 SV=1 90 140 3.0E-08
sp|B6YSQ8|RPOK_THEON DNA-directed RNA polymerase subunit K OS=Thermococcus onnurineus (strain NA1) GN=rpoK PE=3 SV=1 90 140 3.0E-08
sp|C3MUV8|RPOK_SULIM DNA-directed RNA polymerase subunit K OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpoK PE=3 SV=1 89 145 4.0E-08
sp|C3N5H2|RPOK_SULIA DNA-directed RNA polymerase subunit K OS=Sulfolobus islandicus (strain M.16.27) GN=rpoK PE=3 SV=1 89 145 4.0E-08
sp|C4KH38|RPOK_SULIK DNA-directed RNA polymerase subunit K OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpoK PE=3 SV=1 89 145 4.0E-08
sp|Q9HJ14|RPOK_THEAC DNA-directed RNA polymerase subunit K OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoK PE=3 SV=1 90 140 7.0E-08
sp|P0C9D9|RPB6_ASFK5 DNA-directed RNA polymerase subunit 6 homolog OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-081 PE=3 SV=1 55 155 8.0E-08
sp|P0C9D8|RPB6_ASFWA DNA-directed RNA polymerase subunit 6 homolog OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-079 PE=3 SV=1 55 155 9.0E-08
sp|P0C9D7|RPB6_ASFP4 DNA-directed RNA polymerase subunit 6 homolog OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-081 PE=3 SV=1 55 155 9.0E-08
sp|P42484|RPB6_ASFB7 DNA-directed RNA polymerase subunit 6 homolog OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-069 PE=3 SV=1 55 155 4.0E-07
sp|P0C9D6|RPB6_ASFM2 DNA-directed RNA polymerase subunit 6 homolog OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-077 PE=3 SV=1 55 155 4.0E-07
sp|Q08399|RPO6_ASFM2 DNA-directed RNA polymerase subunit 6 homolog OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=PMWK-CL PE=3 SV=1 55 145 8.0E-07
sp|P39463|RPOK_SULAC DNA-directed RNA polymerase subunit K OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoK PE=3 SV=2 89 148 2.0E-06
sp|Q972B1|RPOK_SULTO DNA-directed RNA polymerase subunit K OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpoK PE=3 SV=1 89 148 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0008150 biological_process No
GO:0140098 catalytic activity, acting on RNA No
GO:0046483 heterocycle metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0097747 RNA polymerase activity No
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032774 RNA biosynthetic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003824 catalytic activity No
GO:0016779 nucleotidyltransferase activity No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0090304 nucleic acid metabolic process No
GO:0016740 transferase activity No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5216 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6902
Ophiocordyceps camponoti-floridani Ophcf2|07112
Ophiocordyceps camponoti-rufipedis Ophun1|7379
Ophiocordyceps kimflemingae Ophio5|6762
Ophiocordyceps subramaniannii Hirsu2|5859

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5216
MSDFGDDDVAVGGDEPMLDEDEVTEFYDPEVDAEGEDGDRDANADENQDNDHIVISGDPSAAANAVKSGNKAVKE
KKIPESERTTTPYMTKYERARILGTRALQISMNAPVLVDLEGESDPLMIAIKEMREKKIPLIVRRYLPDGYYEDW
TCEELLQ*
Coding >OphauG2|5216
ATGTCTGATTTTGGCGATGACGATGTCGCTGTGGGCGGCGATGAGCCCATGCTGGACGAGGACGAAGTGACCGAG
TTTTATGATCCCGAAGTCGACGCAGAAGGCGAAGACGGCGACCGCGATGCCAACGCGGACGAGAATCAGGACAAT
GACCACATTGTCATATCAGGAGATCCGTCAGCGGCTGCCAACGCAGTCAAAAGCGGCAACAAGGCAGTCAAGGAA
AAGAAGATTCCCGAGAGTGAGCGCACGACGACGCCGTACATGACCAAGTACGAGCGGGCGCGCATTCTGGGCACG
CGTGCGCTGCAGATAAGCATGAATGCGCCTGTGCTGGTGGACTTGGAGGGCGAGTCGGATCCCCTCATGATTGCA
ATCAAGGAAATGAGAGAAAAGAAGATTCCTCTTATTGTGCGGAGATATCTGCCTGATGGATATTACGAGGACTGG
ACGTGCGAGGAGCTGTTACAATGA
Transcript >OphauG2|5216
ATGTCTGATTTTGGCGATGACGATGTCGCTGTGGGCGGCGATGAGCCCATGCTGGACGAGGACGAAGTGACCGAG
TTTTATGATCCCGAAGTCGACGCAGAAGGCGAAGACGGCGACCGCGATGCCAACGCGGACGAGAATCAGGACAAT
GACCACATTGTCATATCAGGAGATCCGTCAGCGGCTGCCAACGCAGTCAAAAGCGGCAACAAGGCAGTCAAGGAA
AAGAAGATTCCCGAGAGTGAGCGCACGACGACGCCGTACATGACCAAGTACGAGCGGGCGCGCATTCTGGGCACG
CGTGCGCTGCAGATAAGCATGAATGCGCCTGTGCTGGTGGACTTGGAGGGCGAGTCGGATCCCCTCATGATTGCA
ATCAAGGAAATGAGAGAAAAGAAGATTCCTCTTATTGTGCGGAGATATCTGCCTGATGGATATTACGAGGACTGG
ACGTGCGAGGAGCTGTTACAATGA
Gene >OphauG2|5216
ATGTCTGATTTTGGCGATGACGATGTCGCTGTGGGCGGGTAAGATTGACACATTGTTTGGAGCGGCGCAACAGAC
GGACAGGCCCGAGAAATTAACGGACGATAGCGATGAGCCCATGCTGGACGAGGACGAAGTGACCGAGTTTTATGA
TCCCGAAGTCGACGCAGAAGGCGAAGACGGCGACCGCGATGCCAACGCGGACGAGAATCAGGACAATGACCACAT
TGTCATATCAGGAGATCCGTCAGCGGCTGCCAACGCAGTCAAAAGCGGCAACAAGGCAGTCAAGGAAAAGAAGAT
TCCCGAGAGTGAGCGCACGACGACGCCGTACATGACCAAGTACGAGCGGGCGCGCATTCTGGGCACGCGTGCGCT
GCAGATAAGGTAGCTGGGGACTAGCTTGTGCAGGATCGAGTAGGCCCTGGCTAACGGTTCGGACAGCATGAATGC
GCCTGTGCTGGTGGACTTGGAGGGCGAGTCGGATCCCCTCATGATTGCAATCAAGGAAATGAGAGAAAAGAAGAT
TCCTCTTATTGTGCGGAGATATCTGCCTGATGGATAGTATGTGCTTAAAAGCCATGATTTTTTTTTTTTGTTTGA
CGAGCGCTAACTGTGCTAGTTACGAGGACTGGACGTGCGAGGAGCTGTTACAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail