Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5205
Gene name
LocationContig_47:8233..10410
Strand+
Gene length (bp)2177
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) 5.8E-75 242 590
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 1.6E-09 135 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15180|SYKC_YEAST Lysine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRS1 PE=1 SV=2 17 593 0.0E+00
sp|Q9UUE6|SYKC_SCHPO Lysine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krs1 PE=3 SV=1 16 593 0.0E+00
sp|Q99MN1|SYK_MOUSE Lysine--tRNA ligase OS=Mus musculus GN=Kars PE=1 SV=1 35 593 0.0E+00
sp|Q15046|SYK_HUMAN Lysine--tRNA ligase OS=Homo sapiens GN=KARS PE=1 SV=3 18 593 0.0E+00
sp|P37879|SYK_CRIGR Lysine--tRNA ligase OS=Cricetulus griseus GN=KARS PE=1 SV=1 35 593 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15180|SYKC_YEAST Lysine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRS1 PE=1 SV=2 17 593 0.0E+00
sp|Q9UUE6|SYKC_SCHPO Lysine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krs1 PE=3 SV=1 16 593 0.0E+00
sp|Q99MN1|SYK_MOUSE Lysine--tRNA ligase OS=Mus musculus GN=Kars PE=1 SV=1 35 593 0.0E+00
sp|Q15046|SYK_HUMAN Lysine--tRNA ligase OS=Homo sapiens GN=KARS PE=1 SV=3 18 593 0.0E+00
sp|P37879|SYK_CRIGR Lysine--tRNA ligase OS=Cricetulus griseus GN=KARS PE=1 SV=1 35 593 0.0E+00
sp|Q22099|SYK_CAEEL Lysine--tRNA ligase OS=Caenorhabditis elegans GN=krs-1 PE=3 SV=1 35 593 0.0E+00
sp|Q6F2U9|SYK_ORYSJ Lysine--tRNA ligase OS=Oryza sativa subsp. japonica GN=Os03g0586800 PE=2 SV=1 71 593 0.0E+00
sp|Q9ZPI1|SYKC_ARATH Lysine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At3g11710 PE=1 SV=1 52 592 3.0E-179
sp|Q43776|SYK_SOLLC Lysine--tRNA ligase OS=Solanum lycopersicum GN=LYSRS PE=2 SV=1 79 591 1.0E-173
sp|Q8SS56|SYKC_ENCCU Probable lysine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_0580 PE=3 SV=2 70 593 4.0E-156
sp|C4V8R9|SYKC_NOSCE Probable lysine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100909 PE=3 SV=1 79 593 8.0E-155
sp|A9CS74|SYKC_ENTBH Probable lysine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_25548 PE=3 SV=1 77 593 2.0E-150
sp|Q9X231|SYK_THEMA Lysine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lysS PE=3 SV=1 83 593 5.0E-127
sp|A5ILE6|SYK_THEP1 Lysine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=lysS PE=3 SV=1 83 593 4.0E-126
sp|B1LAX6|SYK_THESQ Lysine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=lysS PE=3 SV=1 83 593 5.0E-126
sp|Q2RM49|SYK_MOOTA Lysine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=lysS PE=3 SV=1 83 593 1.0E-124
sp|Q8R7N1|SYK_CALS4 Lysine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=lysS PE=3 SV=1 67 593 2.0E-124
sp|B0KCE4|SYK_THEP3 Lysine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lysS PE=3 SV=1 67 593 2.0E-124
sp|A0PXN4|SYK_CLONN Lysine--tRNA ligase OS=Clostridium novyi (strain NT) GN=lysS PE=3 SV=1 76 592 2.0E-124
sp|Q8YAB8|SYK_LISMO Lysine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lysS PE=3 SV=1 83 591 5.0E-124
sp|Q899G7|SYK_CLOTE Lysine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=lysS PE=3 SV=1 67 592 6.0E-124
sp|Q724I4|SYK_LISMF Lysine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=lysS PE=3 SV=1 83 591 7.0E-124
sp|Q88Z28|SYK_LACPL Lysine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lysS PE=3 SV=1 76 593 3.0E-123
sp|B7JK84|SYK_BACC0 Lysine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=lysS PE=3 SV=1 83 591 4.0E-123
sp|B7ISY7|SYK_BACC2 Lysine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=lysS PE=3 SV=1 110 591 4.0E-123
sp|B0K5C0|SYK_THEPX Lysine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=lysS PE=3 SV=1 67 593 5.0E-123
sp|Q6HPU0|SYK_BACHK Lysine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lysS PE=3 SV=1 83 591 5.0E-123
sp|Q63HC2|SYK_BACCZ Lysine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=lysS PE=3 SV=1 83 591 5.0E-123
sp|Q81VW3|SYK_BACAN Lysine--tRNA ligase OS=Bacillus anthracis GN=lysS PE=3 SV=1 83 591 5.0E-123
sp|A0R8E9|SYK_BACAH Lysine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=lysS PE=3 SV=1 83 591 5.0E-123
sp|A0KNK7|SYK_AERHH Lysine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lysS PE=3 SV=1 76 593 1.0E-122
sp|Q0TMI7|SYK_CLOP1 Lysine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=lysS PE=3 SV=1 67 593 2.0E-122
sp|Q0SQ86|SYK_CLOPS Lysine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=lysS PE=3 SV=1 67 593 2.0E-122
sp|A9VN90|SYK_BACWK Lysine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=lysS PE=3 SV=1 110 591 2.0E-122
sp|A0AF28|SYK_LISW6 Lysine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lysS PE=3 SV=1 83 591 2.0E-122
sp|Q81J70|SYK_BACCR Lysine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lysS PE=3 SV=1 110 591 2.0E-122
sp|B7HJ16|SYK_BACC4 Lysine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=lysS PE=3 SV=1 110 591 2.0E-122
sp|B7HPY8|SYK_BACC7 Lysine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=lysS PE=3 SV=1 83 591 2.0E-122
sp|Q73FD1|SYK_BACC1 Lysine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lysS PE=3 SV=1 83 591 2.0E-122
sp|Q8XHL8|SYK_CLOPE Lysine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=lysS PE=3 SV=1 67 593 2.0E-122
sp|A4WE42|SYK_ENT38 Lysine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=lysS PE=3 SV=1 69 592 3.0E-122
sp|C4LCP0|SYK_TOLAT Lysine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=lysS PE=3 SV=1 89 592 3.0E-122
sp|A4SJK0|SYK_AERS4 Lysine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=lysS PE=3 SV=1 83 593 4.0E-122
sp|Q92F47|SYK_LISIN Lysine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lysS PE=3 SV=1 134 591 4.0E-122
sp|Q839A8|SYK_ENTFA Lysine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=lysS PE=3 SV=1 121 591 5.0E-122
sp|Q050Q1|SYK_LEPBL Lysine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=lysS PE=3 SV=1 80 593 5.0E-122
sp|Q04SM4|SYK_LEPBJ Lysine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=lysS PE=3 SV=1 80 593 5.0E-122
sp|Q8FAT5|SYK2_ECOL6 Lysine--tRNA ligase, heat inducible OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lysU PE=3 SV=3 69 593 6.0E-122
sp|P0A8N5|SYK2_ECOLI Lysine--tRNA ligase, heat inducible OS=Escherichia coli (strain K12) GN=lysU PE=1 SV=2 87 593 6.0E-122
sp|P0A8N6|SYK2_ECO57 Lysine--tRNA ligase, heat inducible OS=Escherichia coli O157:H7 GN=lysU PE=3 SV=2 87 593 6.0E-122
sp|Q9KGG4|SYK_BACHD Lysine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lysS PE=3 SV=1 79 591 8.0E-122
sp|A5FRN5|SYK_DEHMB Lysine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=lysS PE=3 SV=1 88 591 1.0E-121
sp|Q8YPW9|SYK_NOSS1 Lysine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lysS PE=3 SV=1 89 593 2.0E-121
sp|A6L7P5|SYK_BACV8 Lysine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=lysS PE=3 SV=1 88 593 2.0E-121
sp|P37477|SYK_BACSU Lysine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=lysS PE=3 SV=1 83 591 3.0E-121
sp|Q0IDW9|SYK_SYNS3 Lysine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=lysS PE=3 SV=1 87 593 3.0E-121
sp|A5GI38|SYK_SYNPW Lysine--tRNA ligase OS=Synechococcus sp. (strain WH7803) GN=lysS PE=3 SV=1 87 593 4.0E-121
sp|Q8DMA9|SYK_THEEB Lysine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=lysS PE=3 SV=1 87 593 4.0E-121
sp|Q3ZWX9|SYK_DEHMC Lysine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=lysS PE=3 SV=1 88 591 4.0E-121
sp|A7MR65|SYK_CROS8 Lysine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lysS PE=3 SV=1 69 592 5.0E-121
sp|Q3M8C8|SYK_ANAVT Lysine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=lysS PE=3 SV=1 89 593 1.0E-120
sp|A7GJY9|SYK_BACCN Lysine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lysS PE=3 SV=1 83 591 1.0E-120
sp|Q5WLU5|SYK_BACSK Lysine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=lysS PE=3 SV=1 88 591 2.0E-120
sp|Q32BV3|SYK_SHIDS Lysine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lysS PE=3 SV=1 69 592 2.0E-120
sp|Q8XD57|SYK1_ECO57 Lysine--tRNA ligase OS=Escherichia coli O157:H7 GN=lysS PE=3 SV=3 69 592 3.0E-120
sp|B2J384|SYK_NOSP7 Lysine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=lysS PE=3 SV=1 89 593 4.0E-120
sp|A5N4L1|SYK_CLOK5 Lysine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=lysS PE=3 SV=1 134 592 5.0E-120
sp|B1HSY5|SYK_LYSSC Lysine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=lysS PE=3 SV=1 134 591 5.0E-120
sp|P0A8N3|SYK1_ECOLI Lysine--tRNA ligase OS=Escherichia coli (strain K12) GN=lysS PE=1 SV=2 69 592 5.0E-120
sp|P0A8N4|SYK1_ECOL6 Lysine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lysS PE=3 SV=2 69 592 5.0E-120
sp|A5I7P4|SYK_CLOBH Lysine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=lysS PE=3 SV=1 83 593 6.0E-120
sp|A7FZA5|SYK_CLOB1 Lysine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=lysS PE=3 SV=1 83 593 6.0E-120
sp|Q0T106|SYK_SHIF8 Lysine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=lysS PE=3 SV=1 69 592 7.0E-120
sp|B2U0Q7|SYK_SHIB3 Lysine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lysS PE=3 SV=1 69 592 7.0E-120
sp|Q83JU6|SYK1_SHIFL Lysine--tRNA ligase OS=Shigella flexneri GN=lysS PE=3 SV=3 69 592 7.0E-120
sp|Q0B0N3|SYK_SYNWW Lysine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lysS PE=3 SV=1 76 592 9.0E-120
sp|Q5L9E5|SYK_BACFN Lysine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lysS PE=3 SV=1 88 593 1.0E-119
sp|Q72R38|SYK_LEPIC Lysine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lysS PE=3 SV=1 83 593 1.0E-119
sp|A8AP96|SYK_CITK8 Lysine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lysS PE=3 SV=1 69 592 1.0E-119
sp|Q64PM9|SYK_BACFR Lysine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=lysS PE=3 SV=1 88 593 1.0E-119
sp|B1KTC1|SYK_CLOBM Lysine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=lysS PE=3 SV=1 83 593 1.0E-119
sp|A8GIP4|SYK_SERP5 Lysine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=lysS PE=3 SV=1 69 593 2.0E-119
sp|A7GJB3|SYK_CLOBL Lysine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lysS PE=3 SV=1 83 593 2.0E-119
sp|B1IGJ2|SYK_CLOBK Lysine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=lysS PE=3 SV=1 83 593 2.0E-119
sp|Q3A9M2|SYK_CARHZ Lysine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=lysS PE=3 SV=1 83 592 3.0E-119
sp|Q9RHV9|SYK_GEOSE Lysine--tRNA ligase OS=Geobacillus stearothermophilus GN=lysS PE=1 SV=1 83 591 3.0E-119
sp|Q31WF2|SYK_SHIBS Lysine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=lysS PE=3 SV=1 69 592 3.0E-119
sp|Q8F4P5|SYK_LEPIN Lysine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=lysS PE=3 SV=1 83 593 4.0E-119
sp|C0PY12|SYK_SALPC Lysine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=lysS PE=3 SV=1 69 592 5.0E-119
sp|Q03Z44|SYK_LEUMM Lysine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=lysS PE=3 SV=1 118 593 6.0E-119
sp|Q2NRG1|SYK_SODGM Lysine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=lysS PE=3 SV=1 72 593 7.0E-119
sp|A9MRI4|SYK_SALAR Lysine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lysS PE=3 SV=1 69 592 8.0E-119
sp|A5UCQ0|SYK_HAEIE Lysine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=lysS PE=3 SV=1 73 591 9.0E-119
sp|B3QMN9|SYK_CHLP8 Lysine--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=lysS PE=3 SV=1 50 593 1.0E-118
sp|B4TUQ8|SYK_SALSV Lysine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=lysS PE=3 SV=1 69 592 1.0E-118
sp|B5BFK5|SYK_SALPK Lysine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=lysS PE=3 SV=1 69 592 1.0E-118
sp|A9N3L6|SYK_SALPB Lysine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lysS PE=3 SV=1 69 592 1.0E-118
sp|Q5PL30|SYK_SALPA Lysine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lysS PE=3 SV=1 69 592 1.0E-118
sp|B4T535|SYK_SALNS Lysine--tRNA ligase OS=Salmonella newport (strain SL254) GN=lysS PE=3 SV=1 69 592 1.0E-118
sp|B4TGW0|SYK_SALHS Lysine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=lysS PE=3 SV=1 69 592 1.0E-118
sp|B5RE01|SYK_SALG2 Lysine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lysS PE=3 SV=1 69 592 1.0E-118
sp|B5QXG7|SYK_SALEP Lysine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=lysS PE=3 SV=1 69 592 1.0E-118
sp|B5FUF3|SYK_SALDC Lysine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=lysS PE=3 SV=1 69 592 1.0E-118
sp|Q57K76|SYK_SALCH Lysine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=lysS PE=3 SV=1 69 592 1.0E-118
sp|B5F5G4|SYK_SALA4 Lysine--tRNA ligase OS=Salmonella agona (strain SL483) GN=lysS PE=3 SV=1 69 592 1.0E-118
sp|P28354|SYK1_SALTY Lysine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lysS PE=3 SV=3 69 592 1.0E-118
sp|Q6YPY6|SYK_ONYPE Lysine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=lysS PE=3 SV=1 88 591 1.0E-118
sp|Q8Z3X8|SYK1_SALTI Lysine--tRNA ligase OS=Salmonella typhi GN=lysS PE=3 SV=3 69 592 1.0E-118
sp|O67258|SYK_AQUAE Lysine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=lysS PE=3 SV=1 132 590 2.0E-118
sp|P73443|SYK_SYNY3 Lysine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lysS PE=3 SV=1 103 591 3.0E-118
sp|B0URW9|SYK_HISS2 Lysine--tRNA ligase OS=Histophilus somni (strain 2336) GN=lysS PE=3 SV=1 78 591 3.0E-118
sp|B4F0M6|SYK_PROMH Lysine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=lysS PE=3 SV=1 70 592 5.0E-118
sp|B2U8U9|SYK_RALPJ Lysine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=lysS PE=3 SV=1 66 593 5.0E-118
sp|Q2NJZ8|SYK_AYWBP Lysine--tRNA ligase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=lysS PE=3 SV=1 134 591 6.0E-118
sp|Q3K1V5|SYK_STRA1 Lysine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=lysS PE=3 SV=1 136 591 7.0E-118
sp|Q03LD3|SYK_STRTD Lysine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lysS PE=3 SV=1 136 591 7.0E-118
sp|A6L8C6|SYK_PARD8 Lysine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lysS PE=3 SV=1 88 593 7.0E-118
sp|Q8E0I1|SYK_STRA5 Lysine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=lysS PE=3 SV=1 136 591 9.0E-118
sp|Q8E656|SYK_STRA3 Lysine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lysS PE=3 SV=1 136 591 9.0E-118
sp|B1MVJ0|SYK_LEUCK Lysine--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=lysS PE=3 SV=1 118 591 1.0E-117
sp|B2IN95|SYK_STRPS Lysine--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=lysS PE=3 SV=1 88 591 1.0E-117
sp|Q5N1D9|SYK_SYNP6 Lysine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=lysS PE=3 SV=1 103 593 1.0E-117
sp|Q31KH4|SYK_SYNE7 Lysine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=lysS PE=3 SV=1 103 593 1.0E-117
sp|Q1H372|SYK_METFK Lysine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lysS PE=3 SV=1 68 593 2.0E-117
sp|Q4QL88|SYK_HAEI8 Lysine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=lysS PE=3 SV=1 73 591 2.0E-117
sp|Q97RS9|SYK_STRPN Lysine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lysS PE=1 SV=2 88 591 2.0E-117
sp|Q8CWS5|SYK_STRR6 Lysine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lysS PE=3 SV=1 88 591 2.0E-117
sp|B5E317|SYK_STRP4 Lysine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=lysS PE=3 SV=1 88 591 2.0E-117
sp|Q04LI2|SYK_STRP2 Lysine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=lysS PE=3 SV=1 88 591 2.0E-117
sp|Q8A5W4|SYK_BACTN Lysine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lysS PE=3 SV=1 88 593 2.0E-117
sp|B2JIY1|SYK_BURP8 Lysine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=lysS PE=3 SV=1 62 593 2.0E-117
sp|B2RJY1|SYK_PORG3 Lysine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lysS PE=3 SV=1 88 593 2.0E-117
sp|P57822|SYK_PASMU Lysine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=lysS PE=3 SV=1 72 591 3.0E-117
sp|A6VPH6|SYK_ACTSZ Lysine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lysS PE=3 SV=1 88 591 3.0E-117
sp|A8AW92|SYK_STRGC Lysine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=lysS PE=3 SV=1 121 591 4.0E-117
sp|Q4L3H5|SYK_STAHJ Lysine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lysS PE=3 SV=1 116 591 8.0E-117
sp|B1IAN6|SYK_STRPI Lysine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=lysS PE=3 SV=1 88 591 8.0E-117
sp|A3CP17|SYK_STRSV Lysine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=lysS PE=3 SV=1 136 591 9.0E-117
sp|Q8EU10|SYK_OCEIH Lysine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lysS PE=3 SV=1 134 591 9.0E-117
sp|A5UIX4|SYK_HAEIG Lysine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=lysS PE=3 SV=1 73 591 1.0E-116
sp|Q9L3G6|SYK_XANCP Lysine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lysS PE=3 SV=1 60 593 2.0E-116
sp|Q4UU84|SYK_XANC8 Lysine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lysS PE=3 SV=1 60 593 2.0E-116
sp|Q2P1U6|SYK_XANOM Lysine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lysS PE=3 SV=1 61 593 2.0E-116
sp|Q13WZ5|SYK_BURXL Lysine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=lysS PE=3 SV=1 66 593 3.0E-116
sp|Q0BDR2|SYK_BURCM Lysine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=lysS PE=3 SV=1 83 593 3.0E-116
sp|B1YT20|SYK_BURA4 Lysine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=lysS PE=3 SV=1 83 593 3.0E-116
sp|Q9RXE1|SYK_DEIRA Lysine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lysS PE=3 SV=1 93 593 3.0E-116
sp|Q473I5|SYK_CUPPJ Lysine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lysS PE=3 SV=1 64 593 3.0E-116
sp|Q7UZP0|SYK_PROMP Lysine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=lysS PE=3 SV=1 87 593 3.0E-116
sp|A1KUN1|SYK_NEIMF Lysine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=lysS PE=3 SV=1 69 593 3.0E-116
sp|B5XKG9|SYK_STRPZ Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=lysS PE=3 SV=1 136 592 3.0E-116
sp|P0DG47|SYK_STRPQ Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lysS PE=3 SV=1 136 592 4.0E-116
sp|P0DG46|SYK_STRP3 Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lysS PE=3 SV=1 136 592 4.0E-116
sp|Q7U3A4|SYK_PROMM Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=lysS PE=3 SV=1 103 593 4.0E-116
sp|Q9A0V7|SYK_STRP1 Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=lysS PE=3 SV=1 136 592 5.0E-116
sp|Q65SB0|SYK_MANSM Lysine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=lysS PE=3 SV=1 88 591 6.0E-116
sp|B2VF45|SYK_ERWT9 Lysine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lysS PE=3 SV=1 69 592 8.0E-116
sp|B0RSQ8|SYK_XANCB Lysine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=lysS PE=3 SV=1 60 593 8.0E-116
sp|A9AGV1|SYK_BURM1 Lysine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=lysS PE=3 SV=1 83 593 9.0E-116
sp|Q5F6U2|SYK_NEIG1 Lysine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lysS PE=3 SV=1 69 593 9.0E-116
sp|Q6GJF4|SYK_STAAR Lysine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=lysS PE=3 SV=1 134 591 1.0E-115
sp|Q8KCM7|SYK_CHLTE Lysine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lysS PE=3 SV=1 103 593 1.0E-115
sp|P67610|SYK_STAAN Lysine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=lysS PE=1 SV=1 134 591 1.0E-115
sp|P67609|SYK_STAAM Lysine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lysS PE=3 SV=1 134 591 1.0E-115
sp|Q5HIF7|SYK_STAAC Lysine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=lysS PE=3 SV=1 134 591 1.0E-115
sp|Q2YVW8|SYK_STAAB Lysine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lysS PE=3 SV=1 134 591 1.0E-115
sp|Q2G0Q3|SYK_STAA8 Lysine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=lysS PE=3 SV=1 134 591 1.0E-115
sp|Q2FJC3|SYK_STAA3 Lysine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=lysS PE=3 SV=1 134 591 1.0E-115
sp|A7WYS8|SYK_STAA1 Lysine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lysS PE=3 SV=1 134 591 1.0E-115
sp|Q3Z8X9|SYK_DEHM1 Lysine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=lysS PE=3 SV=1 88 591 1.0E-115
sp|A4JFZ6|SYK_BURVG Lysine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=lysS PE=3 SV=1 83 593 2.0E-115
sp|A5EY50|SYK_DICNV Lysine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=lysS PE=3 SV=1 99 593 2.0E-115
sp|Q3B365|SYK_CHLL7 Lysine--tRNA ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lysS PE=3 SV=1 103 593 2.0E-115
sp|Q9JYU6|SYK_NEIMB Lysine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=lysS PE=3 SV=1 69 593 3.0E-115
sp|P43825|SYK_HAEIN Lysine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lysS PE=3 SV=1 73 591 3.0E-115
sp|B4RP57|SYK_NEIG2 Lysine--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=lysS PE=3 SV=1 69 593 3.0E-115
sp|A2RFR7|SYK_STRPG Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=lysS PE=3 SV=1 136 592 3.0E-115
sp|Q8P1X6|SYK_STRP8 Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=lysS PE=3 SV=1 136 592 3.0E-115
sp|Q5XD62|SYK_STRP6 Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lysS PE=3 SV=2 136 592 3.0E-115
sp|Q49V26|SYK_STAS1 Lysine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=lysS PE=3 SV=1 134 591 3.0E-115
sp|A0L6F7|SYK_MAGMM Lysine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lysS PE=3 SV=1 83 593 3.0E-115
sp|B3R478|SYK_CUPTR Lysine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=lysS PE=3 SV=1 65 593 4.0E-115
sp|B2SV97|SYK_XANOP Lysine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=lysS PE=3 SV=1 61 593 4.0E-115
sp|Q8NXZ0|SYK_STAAW Lysine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=lysS PE=3 SV=1 134 591 4.0E-115
sp|Q6GBX1|SYK_STAAS Lysine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=lysS PE=3 SV=1 134 591 4.0E-115
sp|Q5QYV9|SYK_IDILO Lysine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=lysS PE=3 SV=1 73 593 4.0E-115
sp|Q8RG52|SYK_FUSNN Lysine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=lysS PE=3 SV=1 89 592 4.0E-115
sp|A0M5H8|SYK_GRAFK Lysine--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=lysS PE=3 SV=1 129 593 4.0E-115
sp|A5GQ58|SYK_SYNR3 Lysine--tRNA ligase OS=Synechococcus sp. (strain RCC307) GN=lysS PE=3 SV=1 103 593 5.0E-115
sp|A5D5Q4|SYK_PELTS Lysine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lysS PE=3 SV=1 74 592 5.0E-115
sp|A6SXF3|SYK_JANMA Lysine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=lysS PE=3 SV=1 83 593 5.0E-115
sp|Q9JTT7|SYK_NEIMA Lysine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lysS PE=3 SV=1 69 593 6.0E-115
sp|B2GA78|SYK_LACF3 Lysine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=lysS PE=3 SV=1 83 593 6.0E-115
sp|B2SXV7|SYK_BURPP Lysine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lysS PE=3 SV=1 74 593 7.0E-115
sp|B0BP90|SYK_ACTPJ Lysine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=lysS PE=3 SV=1 73 591 7.0E-115
sp|A3N0G9|SYK_ACTP2 Lysine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=lysS PE=3 SV=1 73 591 7.0E-115
sp|A4VTP6|SYK_STRSY Lysine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=lysS PE=3 SV=1 136 591 7.0E-115
sp|A4VZY0|SYK_STRS2 Lysine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=lysS PE=3 SV=1 136 591 7.0E-115
sp|A7I3S8|SYK_CAMHC Lysine--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=lysS PE=3 SV=1 89 592 8.0E-115
sp|A7HM68|SYK_FERNB Lysine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=lysS PE=3 SV=1 87 593 1.0E-114
sp|Q8PLC6|SYK_XANAC Lysine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lysS PE=3 SV=1 56 593 1.0E-114
sp|Q8CQV5|SYK_STAES Lysine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lysS PE=3 SV=1 83 591 1.0E-114
sp|Q5HRN7|SYK_STAEQ Lysine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lysS PE=3 SV=1 83 591 1.0E-114
sp|A3PFA8|SYK_PROM0 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=lysS PE=3 SV=1 87 593 1.0E-114
sp|B7ID87|SYK_THEAB Lysine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=lysS PE=3 SV=1 87 592 2.0E-114
sp|Q7NG18|SYK_GLOVI Lysine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=lysS PE=3 SV=1 103 593 2.0E-114
sp|Q53638|SYK_STAAU Lysine--tRNA ligase OS=Staphylococcus aureus GN=lysS PE=3 SV=1 134 591 2.0E-114
sp|Q3JQP3|SYK_BURP1 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=lysS PE=3 SV=1 83 593 2.0E-114
sp|B4EDB2|SYK_BURCJ Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=lysS PE=3 SV=1 83 593 3.0E-114
sp|Q2FSN8|SYK_METHJ Lysine--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=lysS PE=3 SV=1 103 593 4.0E-114
sp|Q3BUB6|SYK_XANC5 Lysine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lysS PE=3 SV=1 60 593 4.0E-114
sp|A2BZ03|SYK_PROM5 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=lysS PE=3 SV=1 87 593 4.0E-114
sp|Q8DUW8|SYK_STRMU Lysine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lysS PE=3 SV=1 136 591 4.0E-114
sp|Q8PVP6|SYK2_METMA Lysine--tRNA ligase 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=lysS2 PE=3 SV=1 93 593 4.0E-114
sp|B4SB22|SYK_PELPB Lysine--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=lysS PE=3 SV=1 68 593 6.0E-114
sp|Q7MUV7|SYK_PORGI Lysine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lysS PE=3 SV=1 88 593 6.0E-114
sp|Q7N1C8|SYK_PHOLL Lysine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=lysS PE=3 SV=1 70 593 6.0E-114
sp|A8G7C4|SYK_PROM2 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=lysS PE=3 SV=1 87 593 7.0E-114
sp|A0K8P2|SYK_BURCH Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=lysS PE=3 SV=1 83 593 7.0E-114
sp|B1JUZ7|SYK_BURCC Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=lysS PE=3 SV=1 83 593 7.0E-114
sp|Q1BHT1|SYK_BURCA Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=lysS PE=3 SV=1 83 593 7.0E-114
sp|A9BD62|SYK_PROM4 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=lysS PE=3 SV=1 103 593 8.0E-114
sp|Q38V83|SYK_LACSS Lysine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lysS PE=3 SV=1 83 593 9.0E-114
sp|Q031U8|SYK_LACLS Lysine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=lysS PE=3 SV=1 83 591 1.0E-113
sp|A2C629|SYK_PROM3 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=lysS PE=3 SV=1 103 593 1.0E-113
sp|B3H1E8|SYK_ACTP7 Lysine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=lysS PE=3 SV=1 73 591 1.0E-113
sp|C6D8Z6|SYK_PECCP Lysine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=lysS PE=3 SV=1 136 593 1.0E-113
sp|A1JPL4|SYK_YERE8 Lysine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lysS PE=3 SV=1 69 592 1.0E-113
sp|Q2SXD6|SYK_BURTA Lysine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lysS PE=1 SV=1 83 593 2.0E-113
sp|Q318C3|SYK_PROM9 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=lysS PE=3 SV=1 87 593 2.0E-113
sp|Q1LPK6|SYK_CUPMC Lysine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lysS PE=3 SV=1 83 593 2.0E-113
sp|Q6D945|SYK_PECAS Lysine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lysS PE=3 SV=1 69 593 2.0E-113
sp|Q97EB7|SYK_CLOAB Lysine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lysS PE=3 SV=1 123 592 2.0E-113
sp|B1JPH6|SYK_YERPY Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lysS PE=3 SV=1 69 592 3.0E-113
sp|Q666T3|SYK_YERPS Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lysS PE=3 SV=1 69 592 3.0E-113
sp|A4TIC5|SYK_YERPP Lysine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=lysS PE=3 SV=1 69 592 3.0E-113
sp|Q1CF16|SYK_YERPN Lysine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lysS PE=3 SV=1 69 592 3.0E-113
sp|A9R4M4|SYK_YERPG Lysine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lysS PE=3 SV=1 69 592 3.0E-113
sp|Q8ZHK5|SYK_YERPE Lysine--tRNA ligase OS=Yersinia pestis GN=lysS PE=3 SV=1 69 592 3.0E-113
sp|B2K0N6|SYK_YERPB Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lysS PE=3 SV=1 69 592 3.0E-113
sp|Q1CB23|SYK_YERPA Lysine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lysS PE=3 SV=1 69 592 3.0E-113
sp|A7FF39|SYK_YERP3 Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lysS PE=3 SV=1 69 592 3.0E-113
sp|Q7U9X5|SYK_SYNPX Lysine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=lysS PE=3 SV=1 89 593 3.0E-113
sp|A3NX27|SYK_BURP0 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=lysS PE=3 SV=1 83 593 3.0E-113
sp|A1V5L6|SYK_BURMS Lysine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=lysS PE=3 SV=1 83 593 3.0E-113
sp|Q62IZ9|SYK_BURMA Lysine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=lysS PE=3 SV=1 83 593 3.0E-113
sp|A2SAT3|SYK_BURM9 Lysine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=lysS PE=3 SV=1 83 593 3.0E-113
sp|A3ML91|SYK_BURM7 Lysine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=lysS PE=3 SV=1 83 593 3.0E-113
sp|A2RIA0|SYK_LACLM Lysine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lysS PE=3 SV=1 136 591 4.0E-113
sp|A3NB96|SYK_BURP6 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=lysS PE=3 SV=1 83 593 4.0E-113
sp|Q63SN9|SYK_BURPS Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=lysS PE=3 SV=1 83 593 4.0E-113
sp|Q7VLU5|SYK_HAEDU Lysine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lysS PE=3 SV=1 77 591 5.0E-113
sp|Q0KCG3|SYK_CUPNH Lysine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=lysS PE=3 SV=1 83 593 5.0E-113
sp|Q03E09|SYK_PEDPA Lysine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=lysS PE=3 SV=1 83 592 5.0E-113
sp|Q8Y0L5|SYK_RALSO Lysine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=lysS PE=3 SV=1 63 593 6.0E-113
sp|Q3ARD7|SYK_CHLCH Lysine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=lysS PE=3 SV=1 103 593 6.0E-113
sp|A3CY14|SYK_METMJ Lysine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=lysS PE=3 SV=1 87 591 6.0E-113
sp|Q6MUG2|SYK_MYCMS Lysine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lysS PE=3 SV=1 133 592 7.0E-113
sp|Q9CII7|SYK_LACLA Lysine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lysS PE=3 SV=1 136 591 7.0E-113
sp|Q8TSN5|SYK2_METAC Lysine--tRNA ligase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=lysS2 PE=3 SV=1 79 593 1.0E-112
sp|A4G778|SYK_HERAR Lysine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=lysS PE=3 SV=1 75 593 1.0E-112
sp|Q5WVS0|SYK_LEGPL Lysine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=lysS PE=3 SV=1 80 591 1.0E-112
sp|Q2SR35|SYK_MYCCT Lysine--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=lysS PE=3 SV=1 133 593 1.0E-112
sp|A1K5J9|SYK_AZOSB Lysine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=lysS PE=3 SV=1 134 593 2.0E-112
sp|C5BAR6|SYK_EDWI9 Lysine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=lysS PE=3 SV=1 80 593 2.0E-112
sp|A1VYC1|SYK_CAMJJ Lysine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=lysS PE=3 SV=1 103 592 3.0E-112
sp|P41258|SYK_CAMJE Lysine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lysS PE=3 SV=2 103 592 3.0E-112
sp|Q7V9Q0|SYK_PROMA Lysine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=lysS PE=3 SV=1 87 593 4.0E-112
sp|Q5ZUL6|SYK_LEGPH Lysine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lysS PE=3 SV=1 80 591 4.0E-112
sp|A5ICT2|SYK_LEGPC Lysine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=lysS PE=3 SV=1 80 591 4.0E-112
sp|P41255|SYK_THETH Lysine--tRNA ligase OS=Thermus thermophilus GN=lysS PE=1 SV=1 134 593 4.0E-112
sp|Q5SJG7|SYK_THET8 Lysine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=lysS PE=3 SV=1 134 593 4.0E-112
sp|Q72JT9|SYK_THET2 Lysine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lysS PE=3 SV=1 134 593 4.0E-112
sp|A8F4K1|SYK_PSELT Lysine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=lysS PE=3 SV=1 89 590 6.0E-112
sp|Q5HW66|SYK_CAMJR Lysine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=lysS PE=3 SV=1 103 592 6.0E-112
sp|Q5X4D5|SYK_LEGPA Lysine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=lysS PE=3 SV=1 80 591 7.0E-112
sp|A8FKI8|SYK_CAMJ8 Lysine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=lysS PE=3 SV=1 103 592 9.0E-112
sp|Q87SB1|SYK_VIBPA Lysine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lysS PE=3 SV=1 133 593 9.0E-112
sp|A7H4X7|SYK_CAMJD Lysine--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=lysS PE=3 SV=1 103 592 2.0E-111
sp|Q7NZ62|SYK_CHRVO Lysine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lysS PE=3 SV=1 68 593 2.0E-111
sp|Q7MNP6|SYK_VIBVY Lysine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=lysS PE=3 SV=1 133 593 7.0E-111
sp|Q17YS1|SYK_HELAH Lysine--tRNA ligase OS=Helicobacter acinonychis (strain Sheeba) GN=lysS PE=3 SV=1 83 592 8.0E-111
sp|Q3B0J9|SYK_SYNS9 Lysine--tRNA ligase OS=Synechococcus sp. (strain CC9902) GN=lysS PE=3 SV=1 87 593 8.0E-111
sp|Q8DEQ9|SYK_VIBVU Lysine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=lysS PE=3 SV=1 133 593 1.0E-110
sp|B1VA97|SYK_PHYAS Lysine--tRNA ligase OS=Phytoplasma australiense GN=lysS PE=3 SV=1 88 588 1.0E-110
sp|Q47C53|SYK_DECAR Lysine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=lysS PE=3 SV=1 83 593 1.0E-110
sp|B2US13|SYK_HELPS Lysine--tRNA ligase OS=Helicobacter pylori (strain Shi470) GN=lysS PE=3 SV=1 83 592 2.0E-110
sp|B6YRR7|SYK_AZOPC Lysine--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=lysS PE=3 SV=1 89 593 2.0E-110
sp|C5BRM0|SYK_TERTT Lysine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=lysS PE=3 SV=1 67 593 2.0E-110
sp|Q6LUN2|SYK_PHOPR Lysine--tRNA ligase OS=Photobacterium profundum GN=lysS PE=3 SV=1 129 593 3.0E-110
sp|Q9PEB6|SYK_XYLFA Lysine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=lysS PE=3 SV=1 96 593 4.0E-110
sp|Q82SH1|SYK_NITEU Lysine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lysS PE=3 SV=1 89 593 5.0E-110
sp|Q9KU60|SYK_VIBCH Lysine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lysS PE=3 SV=2 133 593 6.0E-110
sp|C1DB68|SYK_LARHH Lysine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=lysS PE=3 SV=1 76 593 6.0E-110
sp|A7MXL2|SYK_VIBCB Lysine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=lysS PE=3 SV=1 133 593 7.0E-110
sp|P56126|SYK_HELPY Lysine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lysS PE=3 SV=1 83 592 7.0E-110
sp|Q3ANE6|SYK_SYNSC Lysine--tRNA ligase OS=Synechococcus sp. (strain CC9605) GN=lysS PE=3 SV=1 89 593 1.0E-109
sp|B6JPT1|SYK_HELP2 Lysine--tRNA ligase OS=Helicobacter pylori (strain P12) GN=lysS PE=3 SV=1 83 592 1.0E-109
sp|A9IQY2|SYK_BORPD Lysine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=lysS PE=3 SV=1 83 593 2.0E-109
sp|Q87EB3|SYK_XYLFT Lysine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=lysS PE=3 SV=1 63 593 2.0E-109
sp|B2I848|SYK_XYLF2 Lysine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=lysS PE=3 SV=1 63 593 2.0E-109
sp|A7NFC6|SYK_ROSCS Lysine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=lysS PE=3 SV=1 83 592 2.0E-109
sp|Q7MAR1|SYK_WOLSU Lysine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=lysS PE=3 SV=1 83 591 3.0E-109
sp|Q1CUX6|SYK_HELPH Lysine--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=lysS PE=3 SV=1 83 592 4.0E-109
sp|B0U572|SYK_XYLFM Lysine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=lysS PE=3 SV=1 63 593 4.0E-109
sp|A1T047|SYK_PSYIN Lysine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=lysS PE=3 SV=1 89 593 5.0E-109
sp|A5UPG6|SYK_ROSS1 Lysine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=lysS PE=3 SV=1 83 592 6.0E-109
sp|Q12JH2|SYK_SHEDO Lysine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lysS PE=3 SV=1 136 593 6.0E-109
sp|Q83E97|SYK_COXBU Lysine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lysS PE=3 SV=1 83 591 6.0E-109
sp|A9NBP7|SYK_COXBR Lysine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=lysS PE=3 SV=1 83 591 6.0E-109
sp|A9KEG1|SYK_COXBN Lysine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=lysS PE=3 SV=1 83 591 6.0E-109
sp|B6J1P6|SYK_COXB2 Lysine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=lysS PE=3 SV=1 83 591 6.0E-109
sp|B6J8K2|SYK_COXB1 Lysine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=lysS PE=3 SV=1 83 591 6.0E-109
sp|B5Z9V6|SYK_HELPG Lysine--tRNA ligase OS=Helicobacter pylori (strain G27) GN=lysS PE=3 SV=1 83 592 8.0E-109
sp|A9L1I0|SYK_SHEB9 Lysine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=lysS PE=3 SV=1 136 593 1.0E-108
sp|A6WS29|SYK_SHEB8 Lysine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=lysS PE=3 SV=1 136 593 1.0E-108
sp|A3D0Y5|SYK_SHEB5 Lysine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=lysS PE=3 SV=1 136 593 1.0E-108
sp|A6LMS4|SYK_THEM4 Lysine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=lysS PE=3 SV=1 87 591 2.0E-108
sp|B6EMX2|SYK_ALISL Lysine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=lysS PE=3 SV=1 133 593 2.0E-108
sp|Q0HRS5|SYK_SHESR Lysine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=lysS PE=3 SV=1 136 593 2.0E-108
sp|Q0HM10|SYK_SHESM Lysine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=lysS PE=3 SV=1 136 593 2.0E-108
sp|A0L0F1|SYK_SHESA Lysine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=lysS PE=3 SV=1 136 593 2.0E-108
sp|A1RGF1|SYK_SHESW Lysine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=lysS PE=3 SV=1 136 593 2.0E-108
sp|A4Y9X9|SYK_SHEPC Lysine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=lysS PE=3 SV=1 136 593 2.0E-108
sp|Q8EI58|SYK_SHEON Lysine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=lysS PE=3 SV=1 136 593 2.0E-108
sp|A1S9M3|SYK_SHEAM Lysine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=lysS PE=3 SV=1 136 593 3.0E-108
sp|B8CU98|SYK_SHEPW Lysine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=lysS PE=3 SV=1 136 593 3.0E-108
sp|Q5NY31|SYK_AROAE Lysine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=lysS PE=3 SV=1 83 593 5.0E-108
sp|A8H0J7|SYK_SHEPA Lysine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=lysS PE=3 SV=1 136 593 7.0E-108
sp|B0TTP2|SYK_SHEHH Lysine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=lysS PE=3 SV=1 136 593 9.0E-108
sp|A3QB36|SYK_SHELP Lysine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=lysS PE=3 SV=1 136 593 1.0E-107
sp|Q1IDW1|SYK_PSEE4 Lysine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=lysS PE=3 SV=1 69 593 1.0E-107
sp|A8ESJ5|SYK_ARCB4 Lysine--tRNA ligase OS=Arcobacter butzleri (strain RM4018) GN=lysS PE=3 SV=1 129 592 1.0E-107
sp|Q9ZMP8|SYK_HELPJ Lysine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lysS PE=3 SV=1 83 592 2.0E-107
sp|A5W890|SYK_PSEP1 Lysine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lysS PE=3 SV=1 69 593 3.0E-107
sp|Q087X1|SYK_SHEFN Lysine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=lysS PE=3 SV=1 136 593 4.0E-107
sp|B1KFR7|SYK_SHEWM Lysine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=lysS PE=3 SV=1 136 593 4.0E-107
sp|P95970|SYK_SULSO Lysine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=lysS PE=3 SV=1 87 590 5.0E-107
sp|Q88MS3|SYK_PSEPK Lysine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=lysS PE=3 SV=1 69 593 7.0E-107
sp|A4SYX2|SYK_POLSQ Lysine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=lysS PE=3 SV=1 83 593 8.0E-107
sp|A5WFG0|SYK_PSYWF Lysine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=lysS PE=3 SV=1 89 591 8.0E-107
sp|B5F9U5|SYK_VIBFM Lysine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=lysS PE=3 SV=1 131 593 8.0E-107
sp|A1AWN8|SYK_RUTMC Lysine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=lysS PE=3 SV=1 121 593 1.0E-106
sp|B0KRL5|SYK_PSEPG Lysine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=lysS PE=3 SV=1 69 593 1.0E-106
sp|B8GRJ2|SYK_THISH Lysine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=lysS PE=3 SV=1 82 593 1.0E-106
sp|B1JD39|SYK_PSEPW Lysine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=lysS PE=3 SV=1 69 593 2.0E-106
sp|Q493E1|SYK_BLOPB Lysine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=lysS PE=3 SV=1 86 593 2.0E-106
sp|A8FRH9|SYK_SHESH Lysine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=lysS PE=3 SV=1 136 593 2.0E-106
sp|Q3SKD9|SYK_THIDA Lysine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=lysS PE=3 SV=1 80 593 3.0E-106
sp|A4XXQ6|SYK_PSEMY Lysine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=lysS PE=3 SV=1 77 593 5.0E-106
sp|Q5E7P8|SYK_VIBF1 Lysine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=lysS PE=3 SV=1 131 593 6.0E-106
sp|Q6KIP6|SYK_MYCMO Lysine--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lysS PE=3 SV=1 88 591 6.0E-106
sp|Q4KHL4|SYK_PSEF5 Lysine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=lysS PE=3 SV=1 83 593 8.0E-106
sp|A6V187|SYK_PSEA7 Lysine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=lysS PE=3 SV=1 120 593 2.0E-105
sp|Q7VZ37|SYK_BORPE Lysine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lysS PE=3 SV=1 134 593 2.0E-105
sp|Q7WK46|SYK_BORBR Lysine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lysS PE=3 SV=1 134 593 3.0E-105
sp|Q057G7|SYK_BUCCC Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=lysS PE=3 SV=1 100 591 4.0E-105
sp|B1XTS4|SYK_POLNS Lysine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=lysS PE=3 SV=1 83 593 4.0E-105
sp|Q3KHF3|SYK_PSEPF Lysine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=lysS PE=3 SV=1 83 593 4.0E-105
sp|Q9HXU0|SYK_PSEAE Lysine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lysS PE=3 SV=1 120 593 6.0E-105
sp|Q02RH2|SYK_PSEAB Lysine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lysS PE=3 SV=1 120 593 6.0E-105
sp|B7V0Z5|SYK_PSEA8 Lysine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=lysS PE=3 SV=1 120 593 7.0E-105
sp|Q7W8T6|SYK_BORPA Lysine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lysS PE=3 SV=1 134 593 7.0E-105
sp|Q4ZWW0|SYK_PSEU2 Lysine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lysS PE=3 SV=1 83 593 7.0E-105
sp|Q4AAC7|SYK_MYCHJ Lysine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=lysS PE=3 SV=2 134 593 1.0E-104
sp|Q886S6|SYK_PSESM Lysine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lysS PE=3 SV=1 83 593 2.0E-104
sp|Q48F26|SYK_PSE14 Lysine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lysS PE=3 SV=1 83 593 2.0E-104
sp|P46191|SYK_MYCHP Lysine--tRNA ligase OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=lysS PE=3 SV=2 77 591 2.0E-104
sp|Q4A8F8|SYK_MYCH7 Lysine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=lysS PE=3 SV=2 134 593 2.0E-104
sp|B3PNH7|SYK_MYCA5 Lysine--tRNA ligase OS=Mycoplasma arthritidis (strain 158L3-1) GN=lysS PE=3 SV=1 87 591 4.0E-104
sp|Q7VFL0|SYK_HELHP Lysine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=lysS PE=3 SV=1 83 592 4.0E-104
sp|C5CSG3|SYK_VARPS Lysine--tRNA ligase OS=Variovorax paradoxus (strain S110) GN=lysS PE=3 SV=1 134 593 5.0E-104
sp|B4UGU5|SYK_ANASK Lysine--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=lysS PE=3 SV=1 136 591 7.0E-104
sp|B8JFW2|SYK_ANAD2 Lysine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lysS PE=3 SV=1 136 591 7.0E-104
sp|Q2IPX5|SYK_ANADE Lysine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lysS PE=3 SV=1 136 591 9.0E-104
sp|A9WK04|SYK_CHLAA Lysine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=lysS PE=3 SV=1 89 591 1.0E-103
sp|A6UDA0|SYK_SINMW Lysine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=lysS PE=3 SV=1 87 588 1.0E-103
sp|Q98QH1|SYK1_MYCPU Lysine--tRNA ligase 1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=lysS1 PE=3 SV=2 120 591 2.0E-103
sp|Q1QT66|SYK_CHRSD Lysine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lysS PE=3 SV=1 69 592 2.0E-103
sp|O87821|SYK_RHIME Lysine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=lysS PE=3 SV=2 87 588 9.0E-103
sp|Q49158|SYK_MYCFP Lysine--tRNA ligase OS=Mycoplasma fermentans (strain ATCC 19989 / NBRC 14854 / NCTC 10117 / PG18) GN=lysS PE=3 SV=2 188 591 1.0E-102
sp|Q4FSV2|SYK_PSYA2 Lysine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lysS PE=3 SV=1 134 591 1.0E-102
sp|Q1LTU4|SYK_BAUCH Lysine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=lysS PE=3 SV=1 83 591 2.0E-102
sp|Q8EUS8|SYK_MYCPE Lysine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=lysS PE=3 SV=1 110 591 7.0E-102
sp|Q1QAW5|SYK_PSYCK Lysine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=lysS PE=3 SV=1 134 591 2.0E-101
sp|Q4JCI5|SYK_SULAC Lysine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=lysS PE=3 SV=1 87 590 7.0E-101
sp|Q98QG4|SYK2_MYCPU Lysine--tRNA ligase 2 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=lysS2 PE=3 SV=1 117 591 1.0E-100
sp|Q43990|SYK_ACIAD Lysine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lysS PE=3 SV=1 76 591 1.0E-100
sp|Q9LJE2|SYKM_ARATH Lysine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA5 PE=2 SV=1 88 591 4.0E-100
sp|A2SDC3|SYK_METPP Lysine--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=lysS PE=3 SV=1 135 593 4.0E-100
sp|Q9PR83|SYK_UREPA Lysine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=lysS PE=3 SV=1 88 591 1.0E-99
sp|B1AI47|SYK_UREP2 Lysine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=lysS PE=3 SV=1 88 591 1.0E-99
sp|B0V9L5|SYK_ACIBY Lysine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=lysS PE=3 SV=1 127 591 9.0E-99
sp|B0VSE0|SYK_ACIBS Lysine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=lysS PE=3 SV=1 127 591 9.0E-99
sp|B7GXW0|SYK_ACIB3 Lysine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=lysS PE=3 SV=1 127 591 9.0E-99
sp|A3M3D6|SYK_ACIBT Lysine--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=lysS PE=3 SV=2 127 591 1.0E-98
sp|O74858|SYKM_SCHPO Lysine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msk1 PE=3 SV=1 136 591 1.0E-98
sp|Q8K9C5|SYK_BUCAP Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lysS PE=3 SV=1 87 591 1.0E-98
sp|A9B5T5|SYK_HERA2 Lysine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=lysS PE=3 SV=1 83 593 3.0E-98
sp|B3Q0S4|SYK_RHIE6 Lysine--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=lysS PE=3 SV=1 70 588 3.0E-98
sp|B5ZAP2|SYK_UREU1 Lysine--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=lysS PE=3 SV=1 88 591 4.0E-97
sp|Q47WT5|SYK_COLP3 Lysine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lysS PE=3 SV=1 136 593 5.0E-97
sp|Q7NC34|SYK_MYCGA Lysine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=lysS PE=3 SV=2 108 593 7.0E-97
sp|B5ZQW5|SYK_RHILW Lysine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lysS PE=3 SV=1 87 588 7.0E-97
sp|Q4A5F3|SYK_MYCS5 Lysine--tRNA ligase OS=Mycoplasma synoviae (strain 53) GN=lysS PE=3 SV=2 184 591 8.0E-97
sp|Q2SL47|SYK_HAHCH Lysine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=lysS PE=3 SV=1 83 592 1.0E-96
sp|Q8D2B3|SYK_WIGBR Lysine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=lysS PE=3 SV=1 152 591 1.0E-96
sp|Q1MBK9|SYK_RHIL3 Lysine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lysS PE=3 SV=1 70 588 2.0E-96
sp|A5CWL4|SYK_VESOH Lysine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=lysS PE=3 SV=1 78 593 4.0E-96
sp|O84786|SYK_CHLTR Lysine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lysS PE=3 SV=1 87 591 5.0E-96
sp|Q3KKR1|SYK_CHLTA Lysine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=lysS PE=3 SV=1 87 591 5.0E-96
sp|P75500|SYK_MYCPN Lysine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=lysS PE=3 SV=1 106 591 7.0E-96
sp|B0BAN6|SYK_CHLTB Lysine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=lysS PE=3 SV=1 87 591 9.0E-96
sp|B0B907|SYK_CHLT2 Lysine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=lysS PE=3 SV=1 87 591 9.0E-96
sp|Q2K424|SYK_RHIEC Lysine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lysS PE=3 SV=1 87 588 2.0E-95
sp|P47382|SYK_MYCGE Lysine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=lysS PE=3 SV=1 106 591 3.0E-95
sp|Q89AC5|SYK_BUCBP Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=lysS PE=3 SV=1 89 592 9.0E-95
sp|P57512|SYK_BUCAI Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lysS PE=3 SV=1 85 592 2.0E-94
sp|Q255U2|SYK_CHLFF Lysine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=lysS PE=3 SV=1 89 591 3.0E-94
sp|Q8U7H6|SYK_AGRFC Lysine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lysS PE=3 SV=1 87 588 4.0E-94
sp|A6W5H6|SYK_KINRD Lysine--tRNA ligase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=lysS PE=3 SV=1 81 592 6.0E-94
sp|Q9PLE1|SYK_CHLMU Lysine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lysS PE=3 SV=1 75 591 7.0E-93
sp|Q821U6|SYK_CHLCV Lysine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=lysS PE=3 SV=1 86 591 2.0E-92
sp|Q5L545|SYK_CHLAB Lysine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=lysS PE=3 SV=1 89 591 2.0E-92
sp|Q7VRF5|SYK_BLOFL Lysine--tRNA ligase OS=Blochmannia floridanus GN=lysS PE=3 SV=1 102 591 1.0E-91
sp|D0LB45|LYSX_GORB4 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Gordonia bronchialis (strain ATCC 25592 / DSM 43247 / JCM 3198 / NCTC 10667) GN=lysX PE=3 SV=1 134 592 7.0E-88
sp|C0ZL89|LYSX_RHOE4 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=lysX PE=3 SV=1 88 592 1.0E-87
sp|Q9Z6X5|SYK_CHLPN Lysine--tRNA ligase OS=Chlamydia pneumoniae GN=lysS PE=3 SV=1 86 591 6.0E-87
sp|Q740J9|LYSX_MYCPA Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=lysX PE=3 SV=1 127 592 4.0E-83
sp|A0QHC4|LYSX_MYCA1 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium avium (strain 104) GN=lysX PE=3 SV=2 127 592 4.0E-83
sp|B1MAX9|LYSX_MYCA9 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=lysX PE=3 SV=1 129 592 6.0E-82
sp|P46861|SYK_MYCLE Lysine--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=lysS PE=3 SV=2 72 592 2.0E-81
sp|A4T5M9|SYK_MYCGI Lysine--tRNA ligase OS=Mycobacterium gilvum (strain PYR-GCK) GN=lysS PE=3 SV=1 79 591 3.0E-81
sp|A0PP57|LYSX_MYCUA Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium ulcerans (strain Agy99) GN=lysX PE=3 SV=2 127 592 6.0E-81
sp|Q5Z3P6|LYSX_NOCFA Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Nocardia farcinica (strain IFM 10152) GN=lysX PE=3 SV=2 82 592 7.0E-81
sp|B2HR11|LYSX_MYCMM Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=lysX PE=3 SV=2 127 592 5.0E-80
sp|A5U8S4|SYK_MYCTA Lysine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lysS PE=3 SV=1 72 592 1.0E-79
sp|C1AI57|SYK_MYCBT Lysine--tRNA ligase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lysS PE=3 SV=1 72 592 1.0E-79
sp|A1KPT4|SYK_MYCBP Lysine--tRNA ligase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lysS PE=3 SV=1 72 592 1.0E-79
sp|P9WFU9|SYK1_MYCTU Lysine--tRNA ligase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lysS1 PE=1 SV=1 72 592 1.0E-79
sp|P9WFU8|SYK1_MYCTO Lysine--tRNA ligase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lysS1 PE=3 SV=1 72 592 1.0E-79
sp|P67608|SYK1_MYCBO Lysine--tRNA ligase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lysS1 PE=3 SV=1 72 592 1.0E-79
sp|A1TAC7|LYSX_MYCVP Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=lysX PE=3 SV=1 65 592 2.0E-79
sp|Q9CC23|LYSX_MYCLE Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium leprae (strain TN) GN=lysX PE=3 SV=2 127 592 1.0E-78
sp|B8ZRJ4|LYSX_MYCLB Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium leprae (strain Br4923) GN=lysX PE=3 SV=2 127 592 1.0E-78
sp|A4T9U2|LYSX_MYCGI Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium gilvum (strain PYR-GCK) GN=lysX PE=3 SV=1 134 592 8.0E-78
sp|Q0SAA3|LYSX_RHOJR Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Rhodococcus jostii (strain RHA1) GN=lysX PE=3 SV=1 102 592 3.0E-77
sp|C1B7Z5|LYSX_RHOOB Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Rhodococcus opacus (strain B4) GN=lysX PE=3 SV=1 102 592 3.0E-77
sp|C6DS31|LYSX_MYCTK Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=lysX PE=3 SV=1 128 592 2.0E-75
sp|P9WFU7|LYSX_MYCTU Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lysX PE=1 SV=1 128 592 3.0E-75
sp|P9WFU6|LYSX_MYCTO Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lysX PE=3 SV=1 128 592 3.0E-75
sp|A5WMW1|LYSX_MYCTF Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium tuberculosis (strain F11) GN=lysX PE=3 SV=1 128 592 3.0E-75
sp|A5U2Z7|LYSX_MYCTA Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lysX PE=3 SV=1 128 592 3.0E-75
sp|C1ANR3|LYSX_MYCBT Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lysX PE=3 SV=1 128 592 1.0E-74
sp|A1KJ57|LYSX_MYCBP Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lysX PE=3 SV=1 128 592 1.0E-74
sp|Q1B7P4|LYSX_MYCSS Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium sp. (strain MCS) GN=lysX PE=3 SV=1 134 592 2.0E-74
sp|A1UHB3|LYSX_MYCSK Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium sp. (strain KMS) GN=lysX PE=3 SV=1 134 592 2.0E-74
sp|Q7VEV7|LYSX_MYCBO Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lysX PE=3 SV=1 128 592 2.0E-74
sp|A3Q0V0|LYSX_MYCSJ Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium sp. (strain JLS) GN=lysX PE=3 SV=1 134 592 4.0E-74
sp|A0QYV1|LYSX_MYCS2 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=lysX PE=3 SV=2 134 592 4.0E-74
sp|P32048|SYKM_YEAST Lysine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSK1 PE=1 SV=3 127 587 1.0E-66
sp|B4EWY8|EPMA_PROMH Elongation factor P--(R)-beta-lysine ligase OS=Proteus mirabilis (strain HI4320) GN=epmA PE=3 SV=1 263 591 6.0E-34
sp|C5BDL9|EPMA_EDWI9 Elongation factor P--(R)-beta-lysine ligase OS=Edwardsiella ictaluri (strain 93-146) GN=epmA PE=3 SV=1 263 587 6.0E-34
sp|C4K3U1|EPMA_HAMD5 Elongation factor P--(R)-beta-lysine ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=epmA PE=3 SV=1 263 589 8.0E-34
sp|C6DFN3|EPMA_PECCP Elongation factor P--(R)-beta-lysine ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=epmA PE=3 SV=1 263 587 3.0E-32
sp|B5Y345|EPMA_KLEP3 Elongation factor P--(R)-beta-lysine ligase OS=Klebsiella pneumoniae (strain 342) GN=epmA PE=3 SV=1 263 587 6.0E-32
sp|A6TH74|EPMA_KLEP7 Elongation factor P--(R)-beta-lysine ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=epmA PE=3 SV=1 263 587 1.0E-31
sp|A8G8T8|EPMA_SERP5 Elongation factor P--(R)-beta-lysine ligase OS=Serratia proteamaculans (strain 568) GN=epmA PE=3 SV=1 263 589 4.0E-31
sp|A8AMP1|EPMA_CITK8 Elongation factor P--(R)-beta-lysine ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=epmA PE=3 SV=1 263 587 3.0E-30
sp|Q6D033|EPMA_PECAS Elongation factor P--(R)-beta-lysine ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=epmA PE=3 SV=1 263 587 4.0E-30
sp|A4W5Q2|EPMA_ENT38 Elongation factor P--(R)-beta-lysine ligase OS=Enterobacter sp. (strain 638) GN=epmA PE=3 SV=1 263 587 1.0E-29
sp|Q7VPM9|EPMA_HAEDU Elongation factor P--(R)-beta-lysine ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=epmA PE=3 SV=1 259 587 1.0E-29
sp|B5BKG8|EPMA_SALPK Elongation factor P--(R)-beta-lysine ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=epmA PE=3 SV=1 263 587 1.0E-29
sp|Q5PLH2|EPMA_SALPA Elongation factor P--(R)-beta-lysine ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=epmA PE=3 SV=1 263 587 1.0E-29
sp|P0A8P0|EPMA_SHIFL Elongation factor P--(R)-beta-lysine ligase OS=Shigella flexneri GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|Q0SXC1|EPMA_SHIF8 Elongation factor P--(R)-beta-lysine ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B2TY33|EPMA_SHIB3 Elongation factor P--(R)-beta-lysine ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|Q1R3A2|EPMA_ECOUT Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B1LQH8|EPMA_ECOSM Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B6I264|EPMA_ECOSE Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain SE11) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B7NG94|EPMA_ECOLU Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|P0A8N7|EPMA_ECOLI Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain K12) GN=epmA PE=1 SV=1 263 587 2.0E-29
sp|P0A8N8|EPMA_ECOL6 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|Q0T9N4|EPMA_ECOL5 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|A8A7Q4|EPMA_ECOHS Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O9:H4 (strain HS) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B1XDQ9|EPMA_ECODH Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain K12 / DH10B) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|C5A1E9|EPMA_ECOBW Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B7M8S0|EPMA_ECO8A Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O8 (strain IAI1) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B7MSX2|EPMA_ECO81 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O81 (strain ED1a) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B7NTL6|EPMA_ECO7I Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B5Z2G6|EPMA_ECO5E Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|P0A8N9|EPMA_ECO57 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O157:H7 GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B7LC16|EPMA_ECO55 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain 55989 / EAEC) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B7MKW2|EPMA_ECO45 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B7UPX7|EPMA_ECO27 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|A7ZV28|EPMA_ECO24 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=epmA PE=3 SV=1 263 587 2.0E-29
sp|B1ITP1|EPMA_ECOLC Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=epmA PE=3 SV=1 263 587 3.0E-29
sp|B2VCV6|EPMA_ERWT9 Elongation factor P--(R)-beta-lysine ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=epmA PE=3 SV=1 263 587 3.0E-29
sp|B4TSD9|EPMA_SALSV Elongation factor P--(R)-beta-lysine ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=epmA PE=3 SV=1 263 587 6.0E-29
sp|C0Q6B6|EPMA_SALPC Elongation factor P--(R)-beta-lysine ligase OS=Salmonella paratyphi C (strain RKS4594) GN=epmA PE=3 SV=1 263 587 6.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0044281 small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0006520 cellular amino acid metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1079
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5205 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6827
Ophiocordyceps camponoti-floridani Ophcf2|03572
Ophiocordyceps camponoti-rufipedis Ophun1|5992
Ophiocordyceps kimflemingae Ophio5|4536
Ophiocordyceps subramaniannii Hirsu2|10058

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5205
MAHNQAAAGSDATAGDAAAAAVAKLHLDEATGDMVSKSELKKRQKAREKDAAKKEKQAANPQPAAPANSNKSAEA
AERDLTPNQYFEIRSRAVNELHAQGKAYPHKYHVTYDIRSFSHDFSHLKNGESDKSRIIQIAGRIYVKRSAGSKL
YFYDIRSDGARLQVLAQADNVGENAPSFDEQHIHLRRGDIIGIRGFPTRTNPKTKQGSGDFSGELSIAATEVTLL
SPCLHQIPDDHYGFKNSEQRFRQRYLDLMMNERSRQIFLTRAKVDTYIRRWFDDRDFVSVQTPMLNPIAGGATAK
PFITHHNDLNMDMFLRVAPELYLKMLVVGGLNRVYEMGRQFRNEGVDLTHNPEFTSLEFYMAYADVNDLIKMTED
LVSGLVKHIHGSYETTFHTIKGEEIKINWQAPWRQIDMIPALEKATSETFPPADELHTEQTGEFLKKVLNKTNVE
CNPPLTNARMIDALVGEFLESQCTNPTFILGHPKMMSPLAKSSRSTPGLCERFEVFVATKEIVNAYTELNVAAEQ
RMRFEEQAHQKAQGDDEAQMVDETFCRALEHGLPPTGGWGMGIDRMMMFLTDNYSIREVLAFPTMKPE*
Coding >OphauG2|5205
ATGGCTCACAATCAAGCAGCCGCTGGCAGCGATGCCACTGCAGGCGATGCTGCTGCCGCGGCAGTGGCCAAGCTC
CATCTTGACGAAGCCACGGGCGACATGGTGTCCAAGTCGGAGCTCAAGAAGCGCCAAAAGGCCCGCGAAAAGGAT
GCCGCCAAGAAGGAAAAGCAGGCTGCCAATCCCCAGCCAGCTGCGCCCGCGAATAGCAACAAGAGCGCCGAGGCC
GCCGAGAGAGACCTCACCCCCAACCAGTACTTTGAAATTCGATCGCGTGCCGTCAATGAGCTTCATGCGCAGGGA
AAGGCTTATCCACACAAGTATCATGTAACGTACGACATTCGCAGCTTTTCCCACGACTTCTCCCATCTCAAGAAT
GGTGAATCAGACAAGTCTAGAATCATACAAATTGCTGGGAGAATCTACGTCAAGCGATCTGCTGGCAGCAAGCTC
TACTTTTACGACATCAGATCAGATGGAGCTCGGCTCCAGGTGCTTGCCCAAGCCGATAATGTTGGAGAGAATGCC
CCTAGCTTTGACGAGCAGCATATTCATCTGCGTCGAGGCGACATCATTGGCATTCGAGGATTTCCTACTCGCACC
AATCCCAAGACGAAGCAGGGAAGCGGTGACTTTTCAGGAGAGCTGTCCATTGCCGCCACCGAGGTCACACTCCTC
TCGCCATGTTTACACCAGATTCCCGACGATCATTACGGCTTCAAGAACTCGGAGCAACGCTTCCGCCAACGCTAT
CTTGACTTGATGATGAACGAGAGATCACGCCAAATATTCCTTACCAGAGCAAAGGTCGATACTTATATTCGCCGA
TGGTTCGACGATCGTGACTTTGTGTCAGTTCAGACGCCAATGCTGAATCCCATTGCCGGCGGCGCCACGGCAAAG
CCCTTTATTACTCACCATAATGACCTCAACATGGACATGTTCCTACGTGTCGCTCCCGAGTTGTATCTCAAGATG
CTCGTCGTTGGTGGTCTGAATCGTGTGTACGAAATGGGACGACAGTTTAGGAATGAAGGCGTCGATCTGACTCAC
AATCCCGAGTTTACGAGCTTGGAGTTTTACATGGCCTATGCCGATGTCAACGATCTCATAAAAATGACGGAAGAC
CTTGTCAGTGGCCTGGTCAAGCACATTCACGGCTCATACGAGACCACCTTTCATACCATCAAGGGAGAAGAGATC
AAGATCAACTGGCAGGCGCCATGGCGTCAGATTGACATGATTCCCGCCCTCGAAAAGGCTACCAGCGAAACCTTT
CCTCCTGCTGATGAATTGCACACTGAACAGACGGGCGAATTTCTCAAAAAGGTTCTAAACAAGACCAATGTCGAG
TGCAACCCGCCCCTAACTAATGCACGGATGATTGATGCATTGGTTGGCGAATTCCTCGAGTCTCAATGCACCAAT
CCAACCTTTATCCTAGGACATCCAAAGATGATGTCACCGCTGGCCAAGTCTTCTCGCAGCACTCCAGGCCTTTGC
GAGCGATTTGAGGTTTTTGTTGCCACCAAGGAGATTGTCAATGCATATACCGAATTGAACGTTGCAGCCGAACAA
CGGATGCGTTTTGAGGAGCAGGCACACCAAAAGGCCCAAGGCGATGACGAGGCACAAATGGTTGACGAGACCTTT
TGCCGGGCTCTGGAGCACGGCTTGCCTCCTACCGGTGGCTGGGGCATGGGCATTGATCGCATGATGATGTTCCTG
ACCGACAATTACAGCATTCGAGAAGTTCTTGCCTTCCCGACGATGAAGCCTGAATAG
Transcript >OphauG2|5205
ATGGCTCACAATCAAGCAGCCGCTGGCAGCGATGCCACTGCAGGCGATGCTGCTGCCGCGGCAGTGGCCAAGCTC
CATCTTGACGAAGCCACGGGCGACATGGTGTCCAAGTCGGAGCTCAAGAAGCGCCAAAAGGCCCGCGAAAAGGAT
GCCGCCAAGAAGGAAAAGCAGGCTGCCAATCCCCAGCCAGCTGCGCCCGCGAATAGCAACAAGAGCGCCGAGGCC
GCCGAGAGAGACCTCACCCCCAACCAGTACTTTGAAATTCGATCGCGTGCCGTCAATGAGCTTCATGCGCAGGGA
AAGGCTTATCCACACAAGTATCATGTAACGTACGACATTCGCAGCTTTTCCCACGACTTCTCCCATCTCAAGAAT
GGTGAATCAGACAAGTCTAGAATCATACAAATTGCTGGGAGAATCTACGTCAAGCGATCTGCTGGCAGCAAGCTC
TACTTTTACGACATCAGATCAGATGGAGCTCGGCTCCAGGTGCTTGCCCAAGCCGATAATGTTGGAGAGAATGCC
CCTAGCTTTGACGAGCAGCATATTCATCTGCGTCGAGGCGACATCATTGGCATTCGAGGATTTCCTACTCGCACC
AATCCCAAGACGAAGCAGGGAAGCGGTGACTTTTCAGGAGAGCTGTCCATTGCCGCCACCGAGGTCACACTCCTC
TCGCCATGTTTACACCAGATTCCCGACGATCATTACGGCTTCAAGAACTCGGAGCAACGCTTCCGCCAACGCTAT
CTTGACTTGATGATGAACGAGAGATCACGCCAAATATTCCTTACCAGAGCAAAGGTCGATACTTATATTCGCCGA
TGGTTCGACGATCGTGACTTTGTGTCAGTTCAGACGCCAATGCTGAATCCCATTGCCGGCGGCGCCACGGCAAAG
CCCTTTATTACTCACCATAATGACCTCAACATGGACATGTTCCTACGTGTCGCTCCCGAGTTGTATCTCAAGATG
CTCGTCGTTGGTGGTCTGAATCGTGTGTACGAAATGGGACGACAGTTTAGGAATGAAGGCGTCGATCTGACTCAC
AATCCCGAGTTTACGAGCTTGGAGTTTTACATGGCCTATGCCGATGTCAACGATCTCATAAAAATGACGGAAGAC
CTTGTCAGTGGCCTGGTCAAGCACATTCACGGCTCATACGAGACCACCTTTCATACCATCAAGGGAGAAGAGATC
AAGATCAACTGGCAGGCGCCATGGCGTCAGATTGACATGATTCCCGCCCTCGAAAAGGCTACCAGCGAAACCTTT
CCTCCTGCTGATGAATTGCACACTGAACAGACGGGCGAATTTCTCAAAAAGGTTCTAAACAAGACCAATGTCGAG
TGCAACCCGCCCCTAACTAATGCACGGATGATTGATGCATTGGTTGGCGAATTCCTCGAGTCTCAATGCACCAAT
CCAACCTTTATCCTAGGACATCCAAAGATGATGTCACCGCTGGCCAAGTCTTCTCGCAGCACTCCAGGCCTTTGC
GAGCGATTTGAGGTTTTTGTTGCCACCAAGGAGATTGTCAATGCATATACCGAATTGAACGTTGCAGCCGAACAA
CGGATGCGTTTTGAGGAGCAGGCACACCAAAAGGCCCAAGGCGATGACGAGGCACAAATGGTTGACGAGACCTTT
TGCCGGGCTCTGGAGCACGGCTTGCCTCCTACCGGTGGCTGGGGCATGGGCATTGATCGCATGATGATGTTCCTG
ACCGACAATTACAGCATTCGAGAAGTTCTTGCCTTCCCGACGATGAAGCCTGAATAG
Gene >OphauG2|5205
ATGGCTCACAATCAAGCAGCCGCTGGCAGCGATGCCACTGCAGGCGATGCTGCTGCCGCGGCAGTGGCCAAGCTC
CATCTTGACGAAGCCACGGGCGACATGGTGTCCAAGTCGGAGCTCAAGAAGCGCCAAAAGGCCCGCGAAAAGGAT
GCCGCCAAGAAGGAAAAGCAGGCTGCCAATCCCCAGCCAGCTGCGCCCGCGAATAGCAACAAGAGCGCCGAGGCC
GCCGAGAGAGACCTCACCCCCAACCAGGCATTTTGACCAGCCCCTCTCCAACAAAACAAAAGACTAATAGCCTAT
TTCTCTACAGTACTTTGAAATTCGATCGCGTGCCGTCAATGAGCTTCATGCGCAGGGAAAGGCTTATCCACACAA
GGTATCTCGAGCCAAACTCTTGCCTCTAACAGCAACACCCCAGTTGACCCTAACCCCGCCTAGTATCATGTAACG
TACGACATTCGCAGCTTTTCCCACGACTTCTCCCATCTCAAGAATGGTGAATCAGACAAGTCTAGAATCATACAA
ATTGCTGGGAGAATCTACGTCAAGCGATCTGCTGGCAGCAAGCTCTACTTTTACGACATCAGATCAGATGTTTGT
CACTCTGCCCATGCTAGCTCGTGCCAACACCAACTGACCAGTTTCATAGGGAGCTCGGCTCCAGGTGCTTGCCCA
AGCCGATAATGTTGGAGAGAATGCCCCTAGCTTTGACGAGCAGCATATTCATCTGCGTCGAGGCGACATCATTGG
CATTCGAGGATTTCCTACTCGCACCAATCCCAAGACGAAGCAGGGAAGCGGTGACTTTTCAGGAGAGCTGTCCAT
TGCCGCCACCGAGGTCACACTCCTCTCGCCATGTTTACACCAGGTACAATGCTTATTCCATGCCAATCCTGAATT
TGCCCCTTACTCTTGTTTTTGGCGACATAGATTCCCGACGATCATTACGGCTTCAAGAACTCGGAGCAACGCTTC
CGCCAACGCTATCTTGACTTGATGATGAACGAGAGATCACGCCAAATATTCCTTACCAGAGCAAAGGTCGATACT
TATATTCGCCGATGGTTCGACGATCGTGACTTTGTGTCAGTTCAGACGCCAATGCTGAATCCCATTGCCGGCGGC
GCCACGGCAAAGCCCTTTATTACTCACCATAATGACCTCAACATGGACATGTTCCTACGTGTCGCTCCCGAGTTG
TATCTCAAGATGCTCGTCGTTGGTGGTCTGAATCGTGTGTACGAAATGGGACGACAGTTTAGGAATGAAGGCGTC
GATCTGACTCACAATCCCGGTACGTCTCTTCATTTATTGCCGTGATACAAGACCCTTCCAGTGCTCACATCTGGC
AGAGTTTACGAGCTTGGAGTTTTACATGGCCTATGCCGATGTCAACGATCTCATAAAAATGACGGAAGACCTTGT
CAGTGGCCTGGTCAAGCACATTCACGGCTCATACGAGACCACCTTTCATACCATCAAGGGAGAAGAGATCAAGAT
CAACTGGCAGGCGCCATGGCGTCAGATTGACATGATTCCCGCCCTCGAAAAGGCTACCAGCGAAACCTTTCCTCC
TGCTGATGAATTGCACACTGAACAGACGGGCGAATTTCTCAAAAAGGTTCTAAACAAGACCAATGTCGAGTGCAA
CCCGCCCCTAACTAATGCACGGATGATTGATGCATTGGTTGGCGAATTCCTCGAGTCTCAATGCGTAGGCCTCGT
CCTTGGTCCAAGAGCCATTAGATACTGACGTCTTGTCTAGACCAATCCAACCTTTATCCTAGGACATCCAAAGAT
GATGTCACCGCTGGCCAAGTCTTCTCGCAGCACTCCAGGCCTTTGCGAGCGATTTGAGGTTTTTGTTGCCACCAA
GGAGATTGTCAATGCGTAAGCCGGCTTGGCCAATCGACTTCGAGGCAGATGCTAACTCGAACAGATATACCGAAT
TGAACGTTGCAGCCGAACAACGGATGCGTTTTGAGGAGCAGGCACACCAAAAGGCCCAAGGCGATGACGAGGCAC
AAATGGTTGACGAGACCTTTTGCCGGGCTCTGGAGCACGGCTTGCCTCCTACCGGTGGCTGGGGCATGGGCATTG
ATCGCATGATGATGTTCCTGACCGACAATTACAGCATTCGAGAAGTTCTTGCCTTCCCGACGATGAAGCCTGAAT
AG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail