Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5201
Gene name
LocationContig_469:5323..13642
Strand-
Gene length (bp)8319
Transcript length (bp)7479
Coding sequence length (bp)7479
Protein length (aa) 2493

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00616 RasGAP GTPase-activator protein for Ras-like GTPase 1.7E-07 1159 1228
PF00616 RasGAP GTPase-activator protein for Ras-like GTPase 5.6E-21 1231 1331
PF13716 CRAL_TRIO_2 Divergent CRAL/TRIO domain 8.5E-06 1492 1626

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P97526|NF1_RAT Neurofibromin OS=Rattus norvegicus GN=Nf1 PE=1 SV=1 687 2301 1.0E-166
sp|Q04690|NF1_MOUSE Neurofibromin OS=Mus musculus GN=Nf1 PE=1 SV=1 635 2301 2.0E-164
sp|P21359|NF1_HUMAN Neurofibromin OS=Homo sapiens GN=NF1 PE=1 SV=2 635 2301 5.0E-163
sp|P19158|IRA2_YEAST Inhibitory regulator protein IRA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRA2 PE=1 SV=2 711 2299 6.0E-85
sp|P18963|IRA1_YEAST Inhibitory regulator protein IRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRA1 PE=1 SV=2 711 2208 1.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P97526|NF1_RAT Neurofibromin OS=Rattus norvegicus GN=Nf1 PE=1 SV=1 687 2301 1.0E-166
sp|Q04690|NF1_MOUSE Neurofibromin OS=Mus musculus GN=Nf1 PE=1 SV=1 635 2301 2.0E-164
sp|P21359|NF1_HUMAN Neurofibromin OS=Homo sapiens GN=NF1 PE=1 SV=2 635 2301 5.0E-163
sp|P19158|IRA2_YEAST Inhibitory regulator protein IRA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRA2 PE=1 SV=2 711 2299 6.0E-85
sp|P18963|IRA1_YEAST Inhibitory regulator protein IRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRA1 PE=1 SV=2 711 2208 1.0E-84
sp|Q54Y08|NGAP_DICDI Probable Ras GTPase-activating-like protein ngap OS=Dictyostelium discoideum GN=ngap PE=2 SV=1 1146 1367 4.0E-34
sp|Q55AR6|NFAA_DICDI Neurofibromin-A OS=Dictyostelium discoideum GN=nfaA PE=3 SV=1 1109 1367 3.0E-29
sp|P20936|RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens GN=RASA1 PE=1 SV=1 1111 1411 5.0E-28
sp|P50904|RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus GN=Rasa1 PE=3 SV=1 1111 1411 7.0E-28
sp|P09851|RASA1_BOVIN Ras GTPase-activating protein 1 OS=Bos taurus GN=RASA1 PE=1 SV=1 1111 1411 4.0E-27
sp|Q5VWQ8|DAB2P_HUMAN Disabled homolog 2-interacting protein OS=Homo sapiens GN=DAB2IP PE=1 SV=2 1111 1405 1.0E-24
sp|Q6P730|DAB2P_RAT Disabled homolog 2-interacting protein OS=Rattus norvegicus GN=Dab2ip PE=1 SV=1 1111 1405 1.0E-24
sp|Q3UHC7|DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus GN=Dab2ip PE=1 SV=1 1111 1405 2.0E-24
sp|Q9UJF2|NGAP_HUMAN Ras GTPase-activating protein nGAP OS=Homo sapiens GN=RASAL2 PE=1 SV=2 1111 1478 7.0E-24
sp|A6QQ91|RASL3_BOVIN RAS protein activator like-3 OS=Bos taurus GN=RASAL3 PE=2 SV=1 1110 1365 2.0E-23
sp|Q86YV0|RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens GN=RASAL3 PE=1 SV=2 1110 1365 3.0E-23
sp|Q8C2K5|RASL3_MOUSE RAS protein activator like-3 OS=Mus musculus GN=Rasal3 PE=1 SV=1 1110 1365 2.0E-22
sp|Q8MLZ5|GAP2_CAEEL Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans GN=gap-2 PE=2 SV=2 1113 1400 5.0E-21
sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=1 SV=1 1113 1360 7.0E-21
sp|O95294|RASL1_HUMAN RasGAP-activating-like protein 1 OS=Homo sapiens GN=RASAL1 PE=1 SV=3 1110 1360 1.0E-20
sp|Q9Z268|RASL1_MOUSE RasGAP-activating-like protein 1 OS=Mus musculus GN=Rasal1 PE=1 SV=2 1110 1360 2.0E-18
sp|O43374|RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sapiens GN=RASA4 PE=2 SV=2 1110 1360 7.0E-18
sp|C9J798|RAS4B_HUMAN Ras GTPase-activating protein 4B OS=Homo sapiens GN=RASA4B PE=3 SV=2 1110 1360 1.0E-17
sp|Q8T498|GAP2_DROME Probable Ras GTPase-activating protein OS=Drosophila melanogaster GN=CG42684 PE=1 SV=3 1177 1404 7.0E-16
sp|P33277|GAP1_SCHPO GTPase-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gap1 PE=3 SV=1 1150 1371 7.0E-16
sp|Q14644|RASA3_HUMAN Ras GTPase-activating protein 3 OS=Homo sapiens GN=RASA3 PE=1 SV=3 1138 1364 1.0E-15
sp|Q9QUH6|SYGP1_RAT Ras/Rap GTPase-activating protein SynGAP OS=Rattus norvegicus GN=Syngap1 PE=1 SV=2 1140 1364 2.0E-15
sp|Q54K32|RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum GN=rgaA PE=1 SV=1 1105 1412 2.0E-15
sp|F6SEU4|SYGP1_MOUSE Ras/Rap GTPase-activating protein SynGAP OS=Mus musculus GN=Syngap1 PE=1 SV=2 1140 1364 3.0E-15
sp|Q96PV0|SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens GN=SYNGAP1 PE=1 SV=4 1140 1364 3.0E-15
sp|Q28013|RASA3_BOVIN Ras GTPase-activating protein 3 OS=Bos taurus GN=RASA3 PE=2 SV=1 1138 1364 9.0E-15
sp|Q9QYJ2|RASA3_RAT Ras GTPase-activating protein 3 OS=Rattus norvegicus GN=Rasa3 PE=1 SV=2 1109 1364 9.0E-14
sp|Q60790|RASA3_MOUSE Ras GTPase-activating protein 3 OS=Mus musculus GN=Rasa3 PE=1 SV=2 1109 1364 1.0E-13
sp|P48423|GAP1_DROME GTPase-activating protein OS=Drosophila melanogaster GN=RasGAP1 PE=1 SV=2 1141 1331 5.0E-13
sp|O00899|GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum GN=gapA PE=1 SV=1 1111 1391 5.0E-13
sp|Q15283|RASA2_HUMAN Ras GTPase-activating protein 2 OS=Homo sapiens GN=RASA2 PE=1 SV=3 1167 1330 2.0E-12
sp|Q63713|RASA2_RAT Ras GTPase-activating protein 2 OS=Rattus norvegicus GN=Rasa2 PE=2 SV=1 1151 1331 5.0E-12
sp|P58069|RASA2_MOUSE Ras GTPase-activating protein 2 OS=Mus musculus GN=Rasa2 PE=1 SV=2 1151 1331 8.0E-12
sp|P33314|BUD2_YEAST Inhibitory regulator protein BUD2/CLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD2 PE=1 SV=2 1137 1386 1.0E-11
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 1059 1394 7.0E-10
sp|Q6PAR5|GAPD1_MOUSE GTPase-activating protein and VPS9 domain-containing protein 1 OS=Mus musculus GN=Gapvd1 PE=1 SV=2 1093 1374 1.0E-09
sp|P35608|NF1_CHICK Neurofibromin (Fragment) OS=Gallus gallus GN=NF1 PE=2 SV=1 2087 2281 2.0E-09
sp|Q14C86|GAPD1_HUMAN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens GN=GAPVD1 PE=1 SV=2 1093 1330 3.0E-09
sp|A5D794|GAPD1_BOVIN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Bos taurus GN=GAPVD1 PE=2 SV=1 1093 1330 5.0E-09
sp|Q04690|NF1_MOUSE Neurofibromin OS=Mus musculus GN=Nf1 PE=1 SV=1 228 384 6.0E-09
sp|A2RV61|GAPD1_XENLA GTPase-activating protein and VPS9 domain-containing protein 1 OS=Xenopus laevis GN=gapvd1 PE=2 SV=1 1093 1374 2.0E-08
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 1111 1396 3.0E-08
sp|P21359|NF1_HUMAN Neurofibromin OS=Homo sapiens GN=NF1 PE=1 SV=2 228 384 3.0E-08
sp|P97526|NF1_RAT Neurofibromin OS=Rattus norvegicus GN=Nf1 PE=1 SV=1 228 384 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0043087 regulation of GTPase activity Yes
GO:0065009 regulation of molecular function No
GO:0051336 regulation of hydrolase activity No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0050790 regulation of catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6671
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5201 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2488
Ophiocordyceps kimflemingae Ophio5|7470
Ophiocordyceps subramaniannii Hirsu2|546

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5201
MPRHIELIDGLVNRLAEKLIWPTRGESEERTGQVIDDDSILTTTRDILVHLSESQQELGSILEPLIVLLEQDLTC
SRTGAREYILSLLGDCCLANWRSLDRVDGSGSTYQEPNDEEINETAQVPPCLDNCLVIRLLDALGSVTEPLKDDY
LLPAPMLLGVHLDADFQGAGSCDGTESLDSVDVSIKTIVEYATASSWSACMAYVRKAISETSLESPTHRDERSTL
TTLRLVGFFWVDSVKLGTMLQEVCSYYLRLGKTAQNTLAAVLPLLIVGWVQRFPSQFTQLHKAGKRLDSSVDRLL
DLIQAAVSNSRKKLALQPLQMALLILRPEVFEAATRLGSTKSSSITKRVHVLDALSKAMRNGNERAVCSLVLLLH
VARHLWDETECSLITYALDVHGDLTRLIVSQATATLDQKTLTSVLFVLVLFPTNNREEMVMETCAKASAHPELQM
ALVKACCLIAKAPTGGSEQRLQFAMPMMQAMLEQQYDESQLSGLLSQTNVDILGATIRLLDTYPSPLIEELSGKR
KEFGFSVPFVKCIFSSHPSIRVAAGRLAMKLSTHTESLDYDQDRCHLGLLFWKQSCAFVPDLCARVQSQGTLYDL
QALHECLRARLNLLQALPALFSIPCDSTNISGLYTSLETTLLVELCTANVEAWRIVTSSIKTVLLELSLLQRYGD
SSQLVASVLSPILRNHAIYLELASLVPCPPGLALCSVLRRMQHPTQGVLSAWELAFDRWIHLAKELSVLSADTTD
DIVLVRWINLSGFLASMASVCIAEGAAALEEEAVSDSRWIDRACDEEGEEPLLVRFLRLSVQLSGCSNSRVRQAM
RRILSDELSPLLHQALLKALESELEVLSTGALASPDGGSDCELVFAEQAAFLIMTTVESLESGCDLITPSPVHLG
ALTLGLAKFVESVPGALGTQGIKIGVCNLCGAITKRKERLNLRDDVRIRNQLVDCLFGWLARPRQQHDGSSDLDV
DTACLKALGLLTFRLPLQAVDVQRENTTSEQKSRKFRTYFNHCLSLITSQPSESNRLMPYSESILASHVDAPTCS
DLVIDILSNLLSANIDVGLKPSLSIGYHQNMNIRAAFLTVLSTILAQGTEFRGFNEAATSEKYQQLLHLLTKDIS
LVLTLSDCCPASEVDELTVCLLTVFEQRGQVFELFETLLRHEIQRTENEAEILRRTCVATKMLSVYAKWKGASYL
RGTLQRVIERLTVSSQDLSLELDPSRVGSAEELQKNAVQLQAVAKAFMDDICASVSIVPASFRRICSIIMKAVSC
RFPNAKYTAVGAFIFLRFICPAIVAPESEGLVVTAPTKEIRRGLLLIAKIIQNLANNVLFGVKEPYMFPLNPFLV
HNIHSVAGFLRDISVAPDHVEIRPNTELVDLGSCVSIHRFVYDHWDQLRQALAHRERREHMRSPAELARGTPSTR
ERLQGLITRLGPPPLAMSWNRPQISANPPPLYSRFQNFMLRNAFRGIESFLTSRAVYDGGESKDGLSIVCVILRH
MENESLDYDTLLYCYLKIASRLWHEPFGLFVDATCYRGRTEPGDDFLASLDLLTPSELSLNLSRLYVYNMNSAFK
KCFRRLLRVSTRNECGAFNPKNVDYHLIGSLQELQAHFHLSQLHLPKETISVVTDTRFVLQPVTRLSKSKGKVDV
VIKVGSQFVQVTTAKKQEVLSGLRLGCAVNDIFRLDEVEESTTTAYSLEENAFGLKADGGRVVMAFTSPKRADVL
EAIRHARDKHVMDDKATRLLDRLVRPQDVPGTMLNLALSNLSGPHHDLRQASYNLLGALCRAFHFEAGSRLFLAS
DLLVPLDASRFVVNMSRQLAQSEPHLTWDFLTEFFLGWPSLLREQRPLGLEYVAPWLSGLRTAVLACEPDCDKGR
EKVAAIFRKLLDSVVMPDRALTHALEHHVWPSVAQDQVLVDIMFDELIKGCLSRGAKTDVWEMASSVLIGIGSIT
LRGRVLSRLRKAINRSSLRPTKSLPENAVWAEVCLLLRFSMALSFDNGIQCQLFLPEVLHIVTMLSDTGGHDFSL
MVHGLLVNTVHAACTSFALNDVRLAKLRASLQVLHERRRKFFARDVWPKAPALTWRHESETTLGVTTAEELTAIL
AEICQVAAPSVDLSNAWRSRWMSLVASTAFQNNPAVQPRAFAVMGYLARGEIDDDLVYQVLVALRGSISQYVEDG
SSEMMASVVTSLSKMMTSLSLASRYGVHLFWLAVSLVRLVSWELLRSAVQLLEAVLINLTTAGDIGEDNVVSVLL
HGHAQLQGATAALDQVLGIRFDGSDTFHFAVCACLVRGLSDMSTRVTAMRVVSCLVEITVSAEQQPSPYLLLMSS
RCMNDEELRDGLWRWPHIDDAQVDVVGICHNMPDEHLGLMIAIVLTDLDRLDEVVQGRALEWVNDVVAGRPAVLS
RICGVLSSVVDSVLLHGQGRAVLRAGNSLLRQLPLQGRNTMAMQTTALDPTFADVVSFATSLTGGRRASEDDRAS
SLECLGLVNGMIEFIIT*
Coding >OphauG2|5201
ATGCCGAGACATATCGAATTGATAGACGGCCTGGTCAATCGTCTGGCGGAAAAGCTCATATGGCCAACGCGCGGA
GAATCAGAGGAAAGAACCGGACAGGTAATAGATGATGATTCGATTCTGACAACGACTCGAGATATTCTAGTACAC
TTGAGCGAATCGCAACAAGAACTAGGGTCTATACTTGAACCGCTCATCGTTCTGCTTGAACAAGACCTGACATGT
TCACGTACGGGTGCCAGGGAATATATTTTGTCTCTGCTTGGTGACTGCTGCCTGGCTAATTGGCGCTCTCTCGAC
CGCGTCGATGGCAGTGGTTCTACTTACCAAGAGCCAAACGATGAAGAAATCAACGAGACGGCACAGGTACCCCCA
TGTCTCGACAACTGTCTTGTAATACGTCTGCTAGATGCTCTGGGGTCGGTCACGGAGCCTCTCAAAGACGACTAT
CTGCTGCCTGCACCCATGCTACTTGGGGTACATCTTGATGCCGATTTTCAAGGTGCAGGCTCATGTGACGGAACC
GAATCCTTGGATAGTGTCGATGTCAGCATCAAGACCATTGTCGAATACGCAACCGCTTCAAGCTGGTCGGCGTGC
ATGGCGTACGTAAGAAAAGCAATATCTGAAACGAGCCTTGAGTCGCCTACACACCGAGACGAAAGGTCGACCCTG
ACGACTCTCCGTCTTGTTGGCTTCTTCTGGGTCGACAGTGTTAAGCTGGGTACCATGCTGCAAGAAGTCTGCTCA
TACTACCTTCGACTTGGAAAAACTGCGCAAAACACACTTGCTGCGGTTCTACCATTGCTTATCGTTGGCTGGGTG
CAAAGGTTTCCTAGTCAGTTTACGCAACTTCATAAAGCTGGAAAACGACTAGACAGCAGCGTTGATAGGCTCTTG
GACCTGATACAGGCGGCGGTAAGCAATAGCAGAAAAAAATTGGCGCTCCAACCACTACAAATGGCTCTCCTAATT
CTACGCCCCGAGGTCTTTGAAGCAGCCACTCGATTGGGGAGCACTAAGAGCAGTAGTATCACCAAAAGGGTTCAT
GTCCTCGATGCACTGAGCAAGGCTATGCGAAACGGCAACGAGCGGGCAGTGTGTTCACTGGTCTTGCTGTTGCAT
GTGGCTCGGCATCTCTGGGACGAGACCGAGTGCTCGCTGATAACCTATGCCCTCGATGTGCACGGAGATTTGACT
AGACTCATCGTATCACAAGCTACGGCCACGTTGGATCAGAAGACACTGACAAGCGTTCTGTTCGTCTTGGTACTA
TTTCCCACGAATAATAGAGAGGAAATGGTGATGGAGACATGTGCCAAGGCTTCGGCTCATCCCGAGCTGCAAATG
GCCTTGGTCAAGGCTTGTTGCTTGATAGCGAAGGCGCCGACCGGCGGCAGCGAGCAGCGACTCCAATTCGCCATG
CCCATGATGCAAGCCATGCTCGAGCAACAATATGACGAGTCCCAGTTATCGGGGCTGCTCTCACAGACAAACGTC
GATATCCTCGGTGCAACAATTAGGCTCCTGGACACGTATCCGTCGCCATTAATCGAAGAACTTTCGGGCAAGCGC
AAAGAGTTTGGCTTCTCCGTGCCCTTTGTTAAGTGTATCTTTTCCTCCCACCCATCGATCAGAGTAGCGGCAGGA
AGACTTGCTATGAAGCTCTCGACGCACACCGAGTCTTTGGATTACGACCAAGACCGATGCCACCTTGGACTCTTG
TTCTGGAAGCAAAGCTGTGCCTTTGTGCCCGACCTATGTGCGCGTGTACAAAGTCAAGGAACATTGTACGACTTG
CAAGCACTGCATGAATGCTTGAGAGCTCGTCTGAACCTGCTTCAGGCTCTGCCTGCCTTGTTTTCCATTCCCTGC
GACTCGACCAATATCTCTGGCTTATATACATCCTTAGAAACGACCCTTCTGGTTGAGCTTTGTACAGCAAATGTG
GAAGCGTGGCGCATCGTCACGTCCTCTATCAAGACTGTTCTTCTTGAACTATCCCTACTCCAGAGATACGGCGAC
TCGAGCCAGCTGGTTGCTTCGGTGTTGTCGCCAATACTGCGCAACCATGCAATTTATCTTGAGCTTGCCTCCCTG
GTCCCCTGCCCCCCTGGTCTGGCCTTGTGCAGCGTGTTGCGAAGGATGCAACACCCAACCCAAGGCGTTCTATCT
GCCTGGGAGCTGGCTTTTGACAGATGGATACACCTGGCCAAGGAATTATCCGTCTTGTCAGCCGACACCACCGAC
GACATAGTCTTGGTGCGATGGATCAACTTGTCTGGATTCCTAGCCTCCATGGCCAGTGTTTGCATTGCAGAAGGG
GCAGCAGCACTGGAAGAAGAAGCTGTGAGCGACTCGCGTTGGATTGATCGTGCCTGCGACGAGGAAGGCGAGGAG
CCCCTATTGGTCCGCTTCTTGAGGCTCAGTGTCCAGTTATCGGGATGCTCCAATTCCAGAGTTCGTCAAGCAATG
CGTCGCATACTGTCTGACGAGCTCTCTCCATTACTTCATCAGGCCTTGCTCAAGGCTCTCGAGTCAGAGCTCGAG
GTACTCTCGACTGGGGCGCTTGCTTCGCCCGATGGCGGATCAGATTGCGAACTCGTCTTTGCCGAGCAGGCTGCC
TTTCTCATCATGACGACGGTGGAGAGTCTGGAGAGTGGCTGCGACTTGATAACACCTTCGCCTGTTCATCTGGGT
GCTCTAACGCTCGGCCTGGCGAAGTTTGTCGAGAGCGTACCGGGGGCATTGGGCACACAGGGCATCAAGATTGGT
GTCTGCAATCTCTGTGGGGCCATTACGAAGCGCAAGGAGCGCTTGAATCTCCGAGATGATGTACGCATCAGAAAC
CAACTAGTTGACTGTCTATTCGGCTGGCTGGCTCGTCCGCGGCAGCAGCATGATGGCTCAAGTGACCTTGACGTG
GATACCGCCTGCCTTAAAGCACTTGGCCTACTTACGTTTAGACTTCCGCTGCAGGCAGTTGATGTGCAAAGAGAA
AACACGACGAGCGAGCAAAAGTCACGCAAATTTCGCACTTATTTCAACCATTGCTTATCTCTCATAACATCACAG
CCTTCGGAGTCCAATAGGTTAATGCCTTATTCGGAATCTATTCTTGCATCTCACGTCGATGCTCCGACGTGCTCC
GACTTGGTCATTGATATTCTCTCAAACCTTTTAAGCGCCAACATCGATGTTGGCCTCAAACCTTCCCTCAGCATT
GGCTATCATCAAAATATGAATATCCGAGCAGCTTTTCTAACTGTTCTCTCAACTATCTTGGCGCAGGGGACAGAA
TTTCGAGGCTTTAACGAAGCGGCTACTAGCGAAAAGTATCAGCAACTATTACACCTGTTGACCAAGGACATCTCT
CTCGTCCTAACACTGAGTGACTGCTGCCCGGCGTCCGAGGTGGATGAGCTGACAGTATGCCTATTGACAGTATTC
GAGCAGCGTGGACAAGTCTTTGAATTGTTTGAAACACTTTTACGGCACGAAATACAACGCACAGAAAACGAGGCC
GAAATCCTGCGCAGAACTTGCGTGGCCACCAAGATGCTCTCCGTCTATGCCAAATGGAAGGGGGCTTCATACCTG
AGGGGGACTCTTCAGAGGGTCATTGAGAGACTCACAGTGTCCTCGCAAGACCTCAGCCTTGAACTTGACCCCTCA
CGGGTTGGCTCGGCAGAAGAGCTACAAAAAAATGCTGTTCAACTCCAAGCAGTGGCCAAAGCCTTCATGGATGAT
ATATGTGCCTCGGTCTCTATTGTTCCTGCCTCATTTCGAAGAATTTGCAGCATTATAATGAAGGCCGTCTCATGT
CGGTTTCCTAATGCCAAGTACACAGCTGTCGGGGCTTTTATATTTCTCCGCTTCATATGTCCTGCCATTGTTGCG
CCCGAATCCGAAGGTCTGGTGGTGACGGCTCCAACCAAGGAAATTCGTCGTGGCCTTCTCCTTATTGCCAAAATC
ATACAAAACCTCGCCAACAATGTCCTTTTCGGCGTCAAGGAGCCTTACATGTTTCCCCTAAACCCCTTTCTTGTT
CACAACATACATTCAGTAGCCGGTTTCCTTCGTGATATATCCGTTGCCCCGGATCATGTCGAGATCCGGCCAAAT
ACCGAGCTTGTCGACCTTGGGTCATGCGTATCCATCCATCGCTTCGTTTATGATCATTGGGATCAGCTTCGTCAG
GCTTTAGCACATAGAGAGCGGAGGGAACATATGCGGAGTCCGGCGGAGCTGGCACGTGGCACTCCATCGACACGC
GAGAGGCTCCAGGGACTCATTACTAGGCTTGGGCCTCCGCCCCTTGCCATGTCTTGGAACCGCCCCCAGATATCG
GCCAATCCACCGCCGCTCTATTCTCGCTTTCAGAACTTTATGCTTCGTAACGCCTTCCGGGGAATTGAGTCTTTT
TTGACTTCTCGTGCAGTCTATGACGGGGGAGAAAGTAAAGATGGGCTTTCAATTGTTTGCGTTATCCTACGACAC
ATGGAGAACGAGAGTCTCGATTATGACACTCTGTTATACTGTTATCTCAAGATTGCAAGTCGACTGTGGCATGAG
CCCTTTGGTCTCTTCGTCGATGCGACCTGTTACCGTGGACGCACCGAGCCGGGTGACGACTTCTTAGCTAGTCTG
GATCTTTTGACGCCATCGGAGCTGTCGCTGAATCTGTCAAGGCTATATGTCTACAATATGAATAGCGCCTTCAAG
AAATGTTTTCGTAGACTGCTGCGAGTTTCTACCCGCAACGAATGCGGCGCCTTCAACCCCAAGAACGTCGATTAC
CATCTAATTGGCAGTCTACAGGAATTGCAGGCACACTTTCACTTGAGTCAGCTCCATCTACCCAAAGAAACTATT
AGTGTCGTCACAGACACTCGCTTTGTCCTGCAACCCGTCACCAGACTTTCAAAGTCCAAGGGCAAGGTCGACGTG
GTAATCAAAGTTGGGAGCCAGTTCGTGCAGGTGACGACGGCTAAGAAGCAAGAGGTGTTGTCTGGGCTACGCCTG
GGATGTGCTGTCAATGACATCTTTCGCTTGGATGAGGTGGAAGAATCGACAACAACTGCATATTCTTTGGAAGAA
AATGCATTCGGCCTGAAGGCCGACGGCGGCAGGGTGGTCATGGCCTTTACAAGTCCAAAGCGGGCTGACGTGCTC
GAAGCCATTCGTCATGCCCGGGACAAGCATGTCATGGACGACAAAGCCACGAGATTGCTGGACAGGCTAGTGCGA
CCGCAGGATGTGCCCGGGACAATGCTCAATCTTGCCCTAAGCAATCTATCTGGGCCTCATCATGATCTCCGGCAA
GCATCCTATAATTTATTGGGAGCGCTCTGCCGGGCCTTTCACTTTGAAGCTGGGTCCAGGTTGTTTTTAGCCAGT
GATCTCTTGGTTCCGCTTGACGCAAGCCGGTTCGTGGTCAATATGAGCAGACAGCTAGCCCAGTCCGAGCCCCAT
CTTACCTGGGATTTCTTGACCGAGTTCTTCCTCGGTTGGCCGAGTCTTCTGCGGGAACAAAGGCCTCTGGGGCTG
GAATATGTGGCGCCTTGGCTATCAGGTCTTCGCACCGCAGTCTTGGCGTGTGAGCCCGACTGTGATAAGGGTCGT
GAAAAGGTGGCTGCCATCTTCAGAAAGCTTCTCGACTCGGTCGTCATGCCAGATCGAGCACTCACACATGCTCTC
GAGCACCACGTATGGCCCTCGGTGGCTCAGGACCAAGTGCTTGTCGACATCATGTTTGATGAACTCATCAAAGGC
TGCCTTAGCCGTGGTGCCAAGACGGACGTGTGGGAAATGGCCTCATCTGTCTTGATTGGCATCGGCAGCATCACC
CTTCGGGGCAGAGTCTTGTCACGACTTCGCAAGGCCATTAACCGTTCTTCATTGCGCCCGACAAAATCGCTACCA
GAAAATGCCGTGTGGGCAGAGGTGTGCCTCCTGCTCCGCTTCAGCATGGCTCTTTCCTTCGACAATGGCATCCAA
TGCCAGCTGTTCCTGCCAGAAGTGTTGCATATAGTGACGATGCTTTCCGACACAGGCGGGCATGACTTCAGCCTC
ATGGTTCATGGGCTGCTCGTCAACACAGTGCATGCGGCCTGTACCTCGTTTGCTCTCAATGACGTCAGATTGGCC
AAGCTCCGGGCAAGCCTCCAGGTACTACACGAGCGGAGAAGGAAATTTTTTGCACGGGATGTATGGCCTAAGGCG
CCTGCATTGACGTGGAGGCATGAGTCAGAGACGACTCTGGGGGTGACTACTGCCGAAGAGCTCACAGCCATACTG
GCCGAAATCTGCCAGGTGGCTGCGCCATCTGTTGACCTGTCGAACGCATGGCGGTCTCGCTGGATGAGCCTTGTT
GCTAGCACGGCTTTCCAGAATAATCCTGCAGTGCAGCCAAGGGCTTTTGCCGTCATGGGATATCTAGCCCGTGGT
GAAATTGACGACGACCTCGTCTATCAAGTTCTGGTGGCGTTGCGCGGTAGTATCAGCCAGTATGTGGAGGACGGC
AGCAGCGAGATGATGGCCTCGGTTGTTACCTCGCTCTCCAAAATGATGACGAGCCTATCTTTGGCGTCGCGCTAT
GGCGTGCACTTGTTTTGGCTTGCTGTGTCGTTGGTCCGGCTGGTGTCGTGGGAGCTCTTAAGGAGCGCAGTGCAA
CTGCTTGAGGCCGTCCTCATCAACTTGACGACAGCGGGCGACATTGGCGAGGACAATGTAGTGTCAGTCTTGCTA
CATGGCCACGCGCAACTACAGGGCGCGACAGCTGCGCTTGACCAAGTTCTTGGTATCCGGTTTGATGGCTCTGAC
ACGTTCCACTTTGCAGTATGCGCTTGTCTGGTGCGAGGCTTGAGTGACATGAGCACAAGAGTCACAGCAATGCGC
GTAGTATCGTGTCTGGTCGAAATCACAGTGTCTGCTGAGCAGCAACCATCGCCCTATCTATTGCTCATGTCATCG
CGCTGCATGAACGACGAGGAACTGAGGGATGGGCTCTGGCGGTGGCCACATATTGATGACGCACAAGTCGATGTG
GTTGGTATTTGCCATAACATGCCGGACGAGCATCTGGGACTCATGATAGCTATTGTGCTCACTGATCTTGACCGC
CTTGACGAGGTAGTGCAGGGGCGTGCTCTTGAGTGGGTCAACGATGTAGTAGCAGGAAGACCAGCTGTGTTGTCG
AGAATATGCGGCGTCCTTTCGAGTGTTGTCGACAGCGTGCTGCTGCACGGTCAAGGTCGTGCTGTACTGCGGGCT
GGGAATTCACTGTTGCGCCAGCTGCCCCTGCAGGGCAGGAACACTATGGCAATGCAGACAACAGCCCTCGATCCG
ACCTTCGCCGATGTGGTGAGCTTTGCCACGTCATTGACAGGGGGGCGAAGAGCTTCAGAGGACGACAGGGCGTCG
AGTTTGGAGTGCCTGGGCTTGGTGAATGGGATGATTGAGTTTATCATTACATGA
Transcript >OphauG2|5201
ATGCCGAGACATATCGAATTGATAGACGGCCTGGTCAATCGTCTGGCGGAAAAGCTCATATGGCCAACGCGCGGA
GAATCAGAGGAAAGAACCGGACAGGTAATAGATGATGATTCGATTCTGACAACGACTCGAGATATTCTAGTACAC
TTGAGCGAATCGCAACAAGAACTAGGGTCTATACTTGAACCGCTCATCGTTCTGCTTGAACAAGACCTGACATGT
TCACGTACGGGTGCCAGGGAATATATTTTGTCTCTGCTTGGTGACTGCTGCCTGGCTAATTGGCGCTCTCTCGAC
CGCGTCGATGGCAGTGGTTCTACTTACCAAGAGCCAAACGATGAAGAAATCAACGAGACGGCACAGGTACCCCCA
TGTCTCGACAACTGTCTTGTAATACGTCTGCTAGATGCTCTGGGGTCGGTCACGGAGCCTCTCAAAGACGACTAT
CTGCTGCCTGCACCCATGCTACTTGGGGTACATCTTGATGCCGATTTTCAAGGTGCAGGCTCATGTGACGGAACC
GAATCCTTGGATAGTGTCGATGTCAGCATCAAGACCATTGTCGAATACGCAACCGCTTCAAGCTGGTCGGCGTGC
ATGGCGTACGTAAGAAAAGCAATATCTGAAACGAGCCTTGAGTCGCCTACACACCGAGACGAAAGGTCGACCCTG
ACGACTCTCCGTCTTGTTGGCTTCTTCTGGGTCGACAGTGTTAAGCTGGGTACCATGCTGCAAGAAGTCTGCTCA
TACTACCTTCGACTTGGAAAAACTGCGCAAAACACACTTGCTGCGGTTCTACCATTGCTTATCGTTGGCTGGGTG
CAAAGGTTTCCTAGTCAGTTTACGCAACTTCATAAAGCTGGAAAACGACTAGACAGCAGCGTTGATAGGCTCTTG
GACCTGATACAGGCGGCGGTAAGCAATAGCAGAAAAAAATTGGCGCTCCAACCACTACAAATGGCTCTCCTAATT
CTACGCCCCGAGGTCTTTGAAGCAGCCACTCGATTGGGGAGCACTAAGAGCAGTAGTATCACCAAAAGGGTTCAT
GTCCTCGATGCACTGAGCAAGGCTATGCGAAACGGCAACGAGCGGGCAGTGTGTTCACTGGTCTTGCTGTTGCAT
GTGGCTCGGCATCTCTGGGACGAGACCGAGTGCTCGCTGATAACCTATGCCCTCGATGTGCACGGAGATTTGACT
AGACTCATCGTATCACAAGCTACGGCCACGTTGGATCAGAAGACACTGACAAGCGTTCTGTTCGTCTTGGTACTA
TTTCCCACGAATAATAGAGAGGAAATGGTGATGGAGACATGTGCCAAGGCTTCGGCTCATCCCGAGCTGCAAATG
GCCTTGGTCAAGGCTTGTTGCTTGATAGCGAAGGCGCCGACCGGCGGCAGCGAGCAGCGACTCCAATTCGCCATG
CCCATGATGCAAGCCATGCTCGAGCAACAATATGACGAGTCCCAGTTATCGGGGCTGCTCTCACAGACAAACGTC
GATATCCTCGGTGCAACAATTAGGCTCCTGGACACGTATCCGTCGCCATTAATCGAAGAACTTTCGGGCAAGCGC
AAAGAGTTTGGCTTCTCCGTGCCCTTTGTTAAGTGTATCTTTTCCTCCCACCCATCGATCAGAGTAGCGGCAGGA
AGACTTGCTATGAAGCTCTCGACGCACACCGAGTCTTTGGATTACGACCAAGACCGATGCCACCTTGGACTCTTG
TTCTGGAAGCAAAGCTGTGCCTTTGTGCCCGACCTATGTGCGCGTGTACAAAGTCAAGGAACATTGTACGACTTG
CAAGCACTGCATGAATGCTTGAGAGCTCGTCTGAACCTGCTTCAGGCTCTGCCTGCCTTGTTTTCCATTCCCTGC
GACTCGACCAATATCTCTGGCTTATATACATCCTTAGAAACGACCCTTCTGGTTGAGCTTTGTACAGCAAATGTG
GAAGCGTGGCGCATCGTCACGTCCTCTATCAAGACTGTTCTTCTTGAACTATCCCTACTCCAGAGATACGGCGAC
TCGAGCCAGCTGGTTGCTTCGGTGTTGTCGCCAATACTGCGCAACCATGCAATTTATCTTGAGCTTGCCTCCCTG
GTCCCCTGCCCCCCTGGTCTGGCCTTGTGCAGCGTGTTGCGAAGGATGCAACACCCAACCCAAGGCGTTCTATCT
GCCTGGGAGCTGGCTTTTGACAGATGGATACACCTGGCCAAGGAATTATCCGTCTTGTCAGCCGACACCACCGAC
GACATAGTCTTGGTGCGATGGATCAACTTGTCTGGATTCCTAGCCTCCATGGCCAGTGTTTGCATTGCAGAAGGG
GCAGCAGCACTGGAAGAAGAAGCTGTGAGCGACTCGCGTTGGATTGATCGTGCCTGCGACGAGGAAGGCGAGGAG
CCCCTATTGGTCCGCTTCTTGAGGCTCAGTGTCCAGTTATCGGGATGCTCCAATTCCAGAGTTCGTCAAGCAATG
CGTCGCATACTGTCTGACGAGCTCTCTCCATTACTTCATCAGGCCTTGCTCAAGGCTCTCGAGTCAGAGCTCGAG
GTACTCTCGACTGGGGCGCTTGCTTCGCCCGATGGCGGATCAGATTGCGAACTCGTCTTTGCCGAGCAGGCTGCC
TTTCTCATCATGACGACGGTGGAGAGTCTGGAGAGTGGCTGCGACTTGATAACACCTTCGCCTGTTCATCTGGGT
GCTCTAACGCTCGGCCTGGCGAAGTTTGTCGAGAGCGTACCGGGGGCATTGGGCACACAGGGCATCAAGATTGGT
GTCTGCAATCTCTGTGGGGCCATTACGAAGCGCAAGGAGCGCTTGAATCTCCGAGATGATGTACGCATCAGAAAC
CAACTAGTTGACTGTCTATTCGGCTGGCTGGCTCGTCCGCGGCAGCAGCATGATGGCTCAAGTGACCTTGACGTG
GATACCGCCTGCCTTAAAGCACTTGGCCTACTTACGTTTAGACTTCCGCTGCAGGCAGTTGATGTGCAAAGAGAA
AACACGACGAGCGAGCAAAAGTCACGCAAATTTCGCACTTATTTCAACCATTGCTTATCTCTCATAACATCACAG
CCTTCGGAGTCCAATAGGTTAATGCCTTATTCGGAATCTATTCTTGCATCTCACGTCGATGCTCCGACGTGCTCC
GACTTGGTCATTGATATTCTCTCAAACCTTTTAAGCGCCAACATCGATGTTGGCCTCAAACCTTCCCTCAGCATT
GGCTATCATCAAAATATGAATATCCGAGCAGCTTTTCTAACTGTTCTCTCAACTATCTTGGCGCAGGGGACAGAA
TTTCGAGGCTTTAACGAAGCGGCTACTAGCGAAAAGTATCAGCAACTATTACACCTGTTGACCAAGGACATCTCT
CTCGTCCTAACACTGAGTGACTGCTGCCCGGCGTCCGAGGTGGATGAGCTGACAGTATGCCTATTGACAGTATTC
GAGCAGCGTGGACAAGTCTTTGAATTGTTTGAAACACTTTTACGGCACGAAATACAACGCACAGAAAACGAGGCC
GAAATCCTGCGCAGAACTTGCGTGGCCACCAAGATGCTCTCCGTCTATGCCAAATGGAAGGGGGCTTCATACCTG
AGGGGGACTCTTCAGAGGGTCATTGAGAGACTCACAGTGTCCTCGCAAGACCTCAGCCTTGAACTTGACCCCTCA
CGGGTTGGCTCGGCAGAAGAGCTACAAAAAAATGCTGTTCAACTCCAAGCAGTGGCCAAAGCCTTCATGGATGAT
ATATGTGCCTCGGTCTCTATTGTTCCTGCCTCATTTCGAAGAATTTGCAGCATTATAATGAAGGCCGTCTCATGT
CGGTTTCCTAATGCCAAGTACACAGCTGTCGGGGCTTTTATATTTCTCCGCTTCATATGTCCTGCCATTGTTGCG
CCCGAATCCGAAGGTCTGGTGGTGACGGCTCCAACCAAGGAAATTCGTCGTGGCCTTCTCCTTATTGCCAAAATC
ATACAAAACCTCGCCAACAATGTCCTTTTCGGCGTCAAGGAGCCTTACATGTTTCCCCTAAACCCCTTTCTTGTT
CACAACATACATTCAGTAGCCGGTTTCCTTCGTGATATATCCGTTGCCCCGGATCATGTCGAGATCCGGCCAAAT
ACCGAGCTTGTCGACCTTGGGTCATGCGTATCCATCCATCGCTTCGTTTATGATCATTGGGATCAGCTTCGTCAG
GCTTTAGCACATAGAGAGCGGAGGGAACATATGCGGAGTCCGGCGGAGCTGGCACGTGGCACTCCATCGACACGC
GAGAGGCTCCAGGGACTCATTACTAGGCTTGGGCCTCCGCCCCTTGCCATGTCTTGGAACCGCCCCCAGATATCG
GCCAATCCACCGCCGCTCTATTCTCGCTTTCAGAACTTTATGCTTCGTAACGCCTTCCGGGGAATTGAGTCTTTT
TTGACTTCTCGTGCAGTCTATGACGGGGGAGAAAGTAAAGATGGGCTTTCAATTGTTTGCGTTATCCTACGACAC
ATGGAGAACGAGAGTCTCGATTATGACACTCTGTTATACTGTTATCTCAAGATTGCAAGTCGACTGTGGCATGAG
CCCTTTGGTCTCTTCGTCGATGCGACCTGTTACCGTGGACGCACCGAGCCGGGTGACGACTTCTTAGCTAGTCTG
GATCTTTTGACGCCATCGGAGCTGTCGCTGAATCTGTCAAGGCTATATGTCTACAATATGAATAGCGCCTTCAAG
AAATGTTTTCGTAGACTGCTGCGAGTTTCTACCCGCAACGAATGCGGCGCCTTCAACCCCAAGAACGTCGATTAC
CATCTAATTGGCAGTCTACAGGAATTGCAGGCACACTTTCACTTGAGTCAGCTCCATCTACCCAAAGAAACTATT
AGTGTCGTCACAGACACTCGCTTTGTCCTGCAACCCGTCACCAGACTTTCAAAGTCCAAGGGCAAGGTCGACGTG
GTAATCAAAGTTGGGAGCCAGTTCGTGCAGGTGACGACGGCTAAGAAGCAAGAGGTGTTGTCTGGGCTACGCCTG
GGATGTGCTGTCAATGACATCTTTCGCTTGGATGAGGTGGAAGAATCGACAACAACTGCATATTCTTTGGAAGAA
AATGCATTCGGCCTGAAGGCCGACGGCGGCAGGGTGGTCATGGCCTTTACAAGTCCAAAGCGGGCTGACGTGCTC
GAAGCCATTCGTCATGCCCGGGACAAGCATGTCATGGACGACAAAGCCACGAGATTGCTGGACAGGCTAGTGCGA
CCGCAGGATGTGCCCGGGACAATGCTCAATCTTGCCCTAAGCAATCTATCTGGGCCTCATCATGATCTCCGGCAA
GCATCCTATAATTTATTGGGAGCGCTCTGCCGGGCCTTTCACTTTGAAGCTGGGTCCAGGTTGTTTTTAGCCAGT
GATCTCTTGGTTCCGCTTGACGCAAGCCGGTTCGTGGTCAATATGAGCAGACAGCTAGCCCAGTCCGAGCCCCAT
CTTACCTGGGATTTCTTGACCGAGTTCTTCCTCGGTTGGCCGAGTCTTCTGCGGGAACAAAGGCCTCTGGGGCTG
GAATATGTGGCGCCTTGGCTATCAGGTCTTCGCACCGCAGTCTTGGCGTGTGAGCCCGACTGTGATAAGGGTCGT
GAAAAGGTGGCTGCCATCTTCAGAAAGCTTCTCGACTCGGTCGTCATGCCAGATCGAGCACTCACACATGCTCTC
GAGCACCACGTATGGCCCTCGGTGGCTCAGGACCAAGTGCTTGTCGACATCATGTTTGATGAACTCATCAAAGGC
TGCCTTAGCCGTGGTGCCAAGACGGACGTGTGGGAAATGGCCTCATCTGTCTTGATTGGCATCGGCAGCATCACC
CTTCGGGGCAGAGTCTTGTCACGACTTCGCAAGGCCATTAACCGTTCTTCATTGCGCCCGACAAAATCGCTACCA
GAAAATGCCGTGTGGGCAGAGGTGTGCCTCCTGCTCCGCTTCAGCATGGCTCTTTCCTTCGACAATGGCATCCAA
TGCCAGCTGTTCCTGCCAGAAGTGTTGCATATAGTGACGATGCTTTCCGACACAGGCGGGCATGACTTCAGCCTC
ATGGTTCATGGGCTGCTCGTCAACACAGTGCATGCGGCCTGTACCTCGTTTGCTCTCAATGACGTCAGATTGGCC
AAGCTCCGGGCAAGCCTCCAGGTACTACACGAGCGGAGAAGGAAATTTTTTGCACGGGATGTATGGCCTAAGGCG
CCTGCATTGACGTGGAGGCATGAGTCAGAGACGACTCTGGGGGTGACTACTGCCGAAGAGCTCACAGCCATACTG
GCCGAAATCTGCCAGGTGGCTGCGCCATCTGTTGACCTGTCGAACGCATGGCGGTCTCGCTGGATGAGCCTTGTT
GCTAGCACGGCTTTCCAGAATAATCCTGCAGTGCAGCCAAGGGCTTTTGCCGTCATGGGATATCTAGCCCGTGGT
GAAATTGACGACGACCTCGTCTATCAAGTTCTGGTGGCGTTGCGCGGTAGTATCAGCCAGTATGTGGAGGACGGC
AGCAGCGAGATGATGGCCTCGGTTGTTACCTCGCTCTCCAAAATGATGACGAGCCTATCTTTGGCGTCGCGCTAT
GGCGTGCACTTGTTTTGGCTTGCTGTGTCGTTGGTCCGGCTGGTGTCGTGGGAGCTCTTAAGGAGCGCAGTGCAA
CTGCTTGAGGCCGTCCTCATCAACTTGACGACAGCGGGCGACATTGGCGAGGACAATGTAGTGTCAGTCTTGCTA
CATGGCCACGCGCAACTACAGGGCGCGACAGCTGCGCTTGACCAAGTTCTTGGTATCCGGTTTGATGGCTCTGAC
ACGTTCCACTTTGCAGTATGCGCTTGTCTGGTGCGAGGCTTGAGTGACATGAGCACAAGAGTCACAGCAATGCGC
GTAGTATCGTGTCTGGTCGAAATCACAGTGTCTGCTGAGCAGCAACCATCGCCCTATCTATTGCTCATGTCATCG
CGCTGCATGAACGACGAGGAACTGAGGGATGGGCTCTGGCGGTGGCCACATATTGATGACGCACAAGTCGATGTG
GTTGGTATTTGCCATAACATGCCGGACGAGCATCTGGGACTCATGATAGCTATTGTGCTCACTGATCTTGACCGC
CTTGACGAGGTAGTGCAGGGGCGTGCTCTTGAGTGGGTCAACGATGTAGTAGCAGGAAGACCAGCTGTGTTGTCG
AGAATATGCGGCGTCCTTTCGAGTGTTGTCGACAGCGTGCTGCTGCACGGTCAAGGTCGTGCTGTACTGCGGGCT
GGGAATTCACTGTTGCGCCAGCTGCCCCTGCAGGGCAGGAACACTATGGCAATGCAGACAACAGCCCTCGATCCG
ACCTTCGCCGATGTGGTGAGCTTTGCCACGTCATTGACAGGGGGGCGAAGAGCTTCAGAGGACGACAGGGCGTCG
AGTTTGGAGTGCCTGGGCTTGGTGAATGGGATGATTGAGTTTATCATTACATGA
Gene >OphauG2|5201
ATGCCGAGACATATCGAATTGATAGACGGCCTGGTCAATCGTCTGGCGGAAAAGGTTGGTGTCTGGCCCAAATCA
TAGCTAGTAAATGCAACTGACGCGAGAAATTCATGCCTAGCTCATATGGCCAACGCGCGGAGAATCAGAGGAAAG
AACCGGACAGGTAATAGATGATGATTCGATTCTGACAACGACTCGAGATATTCTAGTACACTTGAGCGAATCGCA
ACAAGAACTAGGGTCTATACTTGAACCGCTCATCGTTCTGCTTGAACAAGACCTGACATGTTCACGTACGGGTGC
CAGGGAATATATTTTGTCTCTGCTTGGTGACTGCTGCCTGGCTAATTGGCGCTCTCTCGACCGCGTCGATGGCAG
TGGTTCTACTTACCAAGAGCCAAACGATGAAGAAATCAACGAGACGGCACAGGTACCCCCATGTCTCGACAACTG
TCTTGTAATACGTCTGCTAGATGCTCTGGGGTCGGTCACGGAGCCTCTCAAAGACGACTATCTGCTGCCTGCACC
CATGCTACTTGGGGTACATCTTGATGCCGATTTTCAAGGTGCAGGCTCATGTGACGGAACCGAATCCTTGGATAG
TGTCGATGTCAGCATCAAGACCATTGTCGAATACGCAACCGCTTCAAGCTGGTCGGCGTGCATGGCGTACGTAAG
AAAAGCAATATCTGAAACGAGCCTTGAGTCGCCTACACACCGAGACGAAAGGTCGACCCTGACGACTCTCCGTCT
TGTTGGCTTCTTCTGGGTCGACAGTGTTAAGCTGGGTACCATGCTGCAAGAAGTCTGCTCATACTACCTTCGACT
TGGAAAAACTGCGCAAAACACACTTGCTGCGGTTCTACCATTGCTTATCGTTGGCTGGGTGCAAAGGTTTCCTAG
TCAGTTTACGCAACTTCATAAAGCTGGAAAACGACTAGACAGCAGCGTTGATAGGCTCTTGGACCTGATACAGGC
GGCGGTAAGCAATAGCAGAAAAAAATTGGCGCTCCAACCACTACAAATGGCTCTCCTAATTCTACGCCCCGAGGT
CTTTGAAGCAGCCACTCGATTGGGGAGCACTAAGAGCAGTAGTATCACCAAAAGGGTTCATGTCCTCGATGCACT
GAGCAAGGCTATGCGAAACGGCAACGAGCGGGCAGTGTGTTCACTGGTCTTGCTGTTGCATGTGGCTCGGCATCT
CTGGGACGAGACCGAGTGCTCGCTGATAACCTATGCCCTCGATGTGCACGGAGATTTGACTAGACTCATCGTATC
ACAAGCTACGGCCACGTTGGATCAGAAGACACTGACAAGCGTTCTGTTCGTCTTGGTACTATTTCCCACGAATAA
TAGAGAGGAAATGGTGATGGAGACATGTGCCAAGGCTTCGGCTCATCCCGAGCTGCAAATGGCCTTGGTCAAGGC
TTGTTGCTTGATAGCGAAGGCGCCGACCGGCGGCAGCGAGCAGCGACTCCAATTCGCCATGCCCATGATGCAAGC
CATGCTCGAGGTATGCTGTAGCTATGGAACATGTTCCATGTTGATCGGGGCTGAGTGAGAAGACTGTCTGAAGGC
ATGCTGGCTGACTGATGATACCAGCAACAATATGACGAGTCCCAGTTATCGGGGCTGCTCTCACAGACAAACGTC
GATATCCTCGGTGCAACAATTAGGCTCCTGGACACGTATCCGTCGCCATTAATCGAAGAACTTTCGGGCAAGCGC
AAAGAGTTTGGCTTCTCCGTGCCCTTTGTTAAGTGTATCTTTTCCTCCCACCCATCGATCAGAGTAGCGGCAGGA
AGACTTGCTATGAAGCTCTCGACGCACACCGAGTCTTTGGATTACGACCAAGACCGATGCCACCTTGGACTCTTG
TTCTGGAAGCAAAGGCAAGCCATCTACTCGCGCGTGATGTAGCTAAAAATCCTGATTTTCATTTATGGCTAGCTG
TGCCTTTGTGCCCGACCTATGTGCGCGTGTACAAAGTCAAGGAACATTGTACGACTTGCAAGCACTGCATGAATG
CTTGAGAGCTCGTCTGAACCTGCTTCAGGCTCTGCCTGTTGGTCTTTGTCCCTGACTGCTCGTCTTGCGTCACCC
ACTAACGCTGGACTACAGGCCTTGTTTTCCATTCCCTGCGACTCGACCAATATCTCTGGCTTATATACATCCTTA
GAAACGACCCTTCTGGTTGAGCTTTGTACAGCAAATGTGGAAGCGTGGCGCATCGTCACGTCCTCTATCAAGACT
GTTCTTCTTGAACTATCCCTACTCCAGAGATACGGCGACTCGAGCCAGCTGGTTGCTTCGGTGTTGTCGCCAATA
CTGCGCAACCATGCAATTTATCTTGAGCTTGCCTCCCTGGTCCCCTGCCCCCCTGGTCTGGCCTTGTGCAGCGTG
TTGCGAAGGATGCAACACCCAACCCAAGGCGTTCTATCTGCCTGGGAGCTGGCTTTTGACAGATGGATACACCTG
GCCAAGGAATTATCCGTCTTGTCAGCCGACACCACCGACGACATAGTCTTGGTGCGATGGATCAACTTGTCTGGA
TTCCTAGCCTCCATGGCCAGTGTTTGCATTGCAGAAGGGGCAGCAGCACTGGAAGAAGAAGCTGTGAGCGACTCG
CGTTGGATTGATCGTGCCTGCGACGAGGAAGGCGAGGAGCCCCTATTGGTCCGCTTCTTGAGGCTCAGTGTCCAG
TTATCGGGATGCTCCAATTCCAGAGTTCGTCAAGCAATGCGTCGCATACTGTCTGACGAGCTCTCTCCATTACTT
CATCAGGCCTTGCTCAAGGCTCTCGAGTCAGAGCTCGAGGTACTCTCGACTGGGGCGCTTGCTTCGCCCGATGGC
GGATCAGATTGCGAACTCGTCTTTGCCGAGCAGGCTGCCTTTCTCATCATGACGACGGTGGAGAGTCTGGAGAGT
GGCTGCGACTTGATAACACCTTCGCCTGTTCATCTGGGTGCTCTAACGCTCGGCCTGGCGAAGTTTGTCGAGAGC
GTACCGGGGGCATTGGGCACACAGGGCATCAAGATTGGTGTCTGCAATCTCTGTGGGGCCATTACGAAGCGCAAG
GAGCGCTTGAATCTCCGAGATGATGTACGCATCAGAAACCAACTAGTTGACTGTCTATTCGGCTGGCTGGCTCGT
CCGCGGCAGCAGCATGATGGCTCAAGTGACCTTGACGTGGATACCGCCTGCCTTAAAGCACTTGGCCTACTTACG
TTTAGACTTCCGCTGCAGGCAGTTGATGTGCAAAGAGAAAACACGACGAGCGAGCAAAAGTCACGCAAATTTCGC
ACTTATTTCAACCATTGCTTATCTCTCATAACATCACAGCCTTCGGAGTCCAATAGGTTAATGCCTTATTCGGAA
TCTATTCTTGCATCTCACGTCGATGCTCCGACGTGCTCCGACTTGGTCATTGATATTCTCTCAAACCTTTTAAGC
GCCAACATCGATGTTGGCCTCAAACCTTCCCTCAGCATTGGCTATCATCAAAATATGAATATCCGAGCAGCTTTT
CTAACTGTTCTCTCAACTATCTTGGCGCAGGGGACAGAATTTCGAGGCTTTAACGAAGCGGCTACTAGCGAAAAG
TATCAGCAACTATTACACGTATGTTTCACACTTTCATTCTGCGCATTACATCATGTCGATGACAGATGCTAACAC
ATCGCAGCTGTTGACCAAGGACATCTCTCTCGTCCTAACACTGAGTGACTGCTGCCCGGCGTCCGAGGTGGATGA
GCTGACAGTATGCCTATTGACAGTATTCGAGCAGCGTGGACAAGTCTTTGAATTGTTTGAAACACTTTTACGGCA
CGAAATACAACGCACAGGTATAGCCTCATGTATTTTGCATTAAGTTTATCAGACTCTAACTGCTGTTCTTATCAT
CCCTGTTATTGCTATTATTGCAGAAAACGAGGCCGAAATCCTGCGCAGAACTTGCGTGGCCACCAAGATGCTCTC
CGTCTATGCCAAATGGAAGGGGGCTTCATACCTGAGGGGGACTCTTCAGAGGGTCATTGAGAGACTCACAGTGTC
CTCGCAAGACCTCAGCCTTGAACTTGACCCCTCACGGGTTGGCTCGGCAGAAGAGCTACAAAAAAATGCTGTTCA
ACTCCAAGCAGTGGCCAAAGCCTTCATGGATGATATATGTGCCTCGGTCTCTATTGTTCCTGCCTCATTTCGAAG
AATTTGCAGCATTGTATGTGCACTCGGGAGACTTCTGCAAGATGAGAACAGGCTGATACCGATGAATAGATAATG
AAGGCCGTCTCATGTCGGTTTCCTAATGCCAAGTACACAGCTGTCGGGGCTTTTATATTTCTCCGCTTCATATGT
CCTGCCATTGTTGCGCCCGAATCCGAAGGTCTGGTGGTGACGGCTCCAACCAAGGAAATTCGTCGTGGCCTTCTC
CTTATTGCCAAAATCATACAAAACCTCGCCAACAATGTCCTTTTCGGCGTCAAGGAGCCTTACATGTTTCCCCTA
AACCCCTTTCTTGTTCACAACATACATTCAGTAGCCGGTTTCCTTCGTGATATATCCGTCAGTGGCTCTAGAAAC
AGGCCATAAGAGGGGAAAAAAAACTAACCAAGTCTCAGGTTGCCCCGGATCATGTCGAGATCCGGCCAAATACCG
AGCTTGTCGACCTTGGGTCATGCGTATCCATCCATCGCTTCGTTTATGATCATTGGGATCAGCTTCGTCAGGCTT
TAGCACATAGAGAGCGGAGGGAACATATGCGGAGTCCGGCGGAGCTGGCACGTGGCACTCCATCGACACGCGAGA
GGCTCCAGGGACTCATTACTAGGCTTGGGCCTCCGCCCCTTGCCATGTCTTGGAACCGCCCCCAGATATCGGCCA
ATCCACCGCCGCTCTATTCTCGCTTTCAGAACTTTATGCTTCGTAACGCCTTCCGGGGAATTGAGTCTTTTTTGA
CTTCTCGTGCAGTCTATGACGGGGGAGAAAGTAAAGTGTGTCTTATCTGCGGCTCCCGCTTGGTTGCTCAATTCC
ACATACCTTTTCTTACATTGTCACAGGATGGGCTTTCAATTGTTTGCGTTATCCTACGACACATGGAGAACGAGA
GTCTCGATTATGACACTCTGTTATACTGTTATCTCAAGGTAATAAGGGTCATATGGTGGAATAACCGTTGTGTAT
TGACGAGGCTGCCAGATTGCAAGTCGACTGTGGCATGAGCCCTTTGGTCTCTTCGTCGATGCGACCTGTTACCGT
GGACGCACCGAGCCGGGTGACGACTTCTTAGCTAGTCTGGATCTTTTGACGCCATCGGAGCTGTCGCTGAATCTG
TCAAGGCTATATGTCTACAATATGAATAGCGCCTTCAAGTCAGTCAGGGGGAAGGAAAAGACGGACTGCGAGGAA
AGCTATAGAGGCTGACAAGGCTGAGTGCAGGAAATGTTTTCGTAGACTGCTGCGAGTTTCTACCCGCAACGAATG
CGGCGCCTTCAACCCCAAGAACGTCGATTACCATCTAATTGGCAGTCTACAGGAATTGCAGGCACACTTTCACTT
GAGTCAGCTCCATCTACCCAAAGAAACTATTAGTGTCGTCACAGACACTCGCTTTGTCCTGCAACCCGTCACCAG
ACTTTCAAAGTCCAAGGGCAAGGTCGACGTGGTAATCAAAGTTGGGAGCCAGTTCGTGCAGGTGACGACGGCTAA
GAAGCAAGAGGTGTTGTCTGGGCTACGCCTGGGATGTGCTGTCAATGACATCTTTCGCTTGGATGAGGTGGAAGA
ATCGACAACAACTGCATATTCTTTGGAAGAAAATGCATTCGGCCTGAAGGCCGACGGCGGCAGGGTGGTCATGGC
CTTTACAAGTCCAAAGCGGGCTGACGTGCTCGAAGCCATTCGTCATGCCCGGGACAAGCATGTCATGGACGACAA
AGCCACGAGATTGCTGGACAGGCTAGTGCGACCGCAGGATGTGCCCGGGACAATGCTCAATCTTGCCCTAAGCAA
TCTATCTGGGCCTCATCATGATCTCCGGCAAGCATCCTATAATTTATTGGGAGCGCTCTGCCGGGCCTTTCACTT
TGAAGCTGGGTCCAGGTTGTTTTTAGCCAGTGGTATGGGATATGATGGCTTCCTATTTGCCTGGACATGTTATTA
GTACGACTAACAGGGACGAGGCAGATCTCTTGGTTCCGCTTGACGCAAGCCGGTTCGTGGTCAATATGAGCAGAC
AGCTAGCCCAGTCCGAGCCCCATCTTACCTGGGATTTCTTGACCGAGTTCTTCCTCGGTTGGCCGAGTCTTCTGC
GGGAACAAAGGCCTCTGGGGCTGGAATATGTGGCGCCTTGGCTATCAGGTCTTCGCACCGCAGTCTTGGCGTGTG
AGCCCGACTGTGATAAGGGTCGTGAAAAGGTGGCTGCCATCTTCAGAAAGCTTCTCGACTCGGTCGTCATGCCAG
ATCGAGCACTCACACATGCTCTCGAGCACCACGTATGGCCCTCGGTGGCTCAGGACCAAGTGCTTGTCGACATCA
TGTTTGATGAACTCATCAAAGGCTGCCTTAGCCGTGGTGCCAAGACGGACGTGTGGGAAATGGCCTCATCTGTCT
TGATTGGCATCGGCAGCATCACCCTTCGGGGCAGAGTCTTGTCACGACTTCGCAAGGCCATTAACCGTTCTTCAT
TGCGCCCGACAAAATCGCTACCAGAAAATGCCGTGTGGGCAGAGGTGTGCCTCCTGCTCCGCTTCAGCATGGCTC
TTTCCTTCGACAATGGCATCCAATGCCAGCTGTTCCTGCCAGAAGTGTTGCATATAGTGACGATGCTTTCCGACA
CAGGCGGGCATGACTTCAGCCTCATGGTTCATGGGCTGCTCGTCAACACAGTGCATGCGGCCTGTACCTCGTTTG
CTCTCAATGACGTCAGATTGGCCAAGCTCCGGGCAAGCCTCCAGGTACTACACGAGCGGAGAAGGAAATTTTTTG
CACGGGATGTATGGCCTAAGGCGCCTGCATTGACGTGGAGGCATGAGTCAGAGACGACTCTGGGGGTGACTACTG
CCGAAGAGCTCACAGCCATACTGGCCGAAATCTGCCAGGTGGCTGCGCCATCTGTTGACCTGTCGAACGCATGGC
GGTCTCGCTGGATGAGCCTTGTTGCTAGCACGGCTTTCCAGAATAATCCTGCAGTGCAGCCAAGGGCTTTTGCCG
TCATGGGATATCTAGCCCGTGGTGAAATTGACGACGACCTCGTCTATCAAGTTCTGGTGGCGTTGCGCGGTAGTA
TCAGCCAGTATGTGGAGGACGGCAGCAGCGAGATGATGGCCTCGGTTGTTACCTCGCTCTCCAAAATGATGACGA
GCCTATCTTTGGCGTCGCGCTATGGCGTGCACTTGTTTTGGCTTGCTGTGTCGTTGGTCCGGCTGGTGTCGTGGG
AGCTCTTAAGGAGCGCAGTGCAACTGCTTGAGGCCGTCCTCATCAACTTGACGACAGCGGGCGACATTGGCGAGG
ACAATGTAGTGTCAGTCTTGCTACATGGCCACGCGCAACTACAGGGCGCGACAGCTGCGCTTGACCAAGTTCTTG
GTATCCGGTTTGATGGCTCTGACACGTTCCACTTTGCAGTATGCGCTTGTCTGGTGCGAGGCTTGAGTGACATGA
GCACAAGAGTCACAGCAATGCGCGTAGTATCGTGTCTGGTCGAAATCACAGTGTCTGCTGAGCAGCAACCATCGC
CCTATCTATTGCTCATGTCATCGCGCTGCATGAACGACGAGGAACTGAGGGATGGGCTCTGGCGGTGGCCACATA
TTGATGACGCACAAGTCGATGTGGTTGGTATTTGCCATAACATGCCGGACGAGCATCTGGGACTCATGATAGCTA
TTGTGCTCACTGATCTTGACCGCCTTGACGAGGTAGTGCAGGGGCGTGCTCTTGAGTGGGTCAACGATGTAGTAG
CAGGAAGACCAGCTGTGTTGTCGAGAATATGCGGCGTCCTTTCGAGTGTTGTCGACAGCGTGCTGCTGCACGGTC
AAGGTCGTGCTGTACTGCGGGCTGGGAATTCACTGTTGCGCCAGCTGCCCCTGCAGGGCAGGAACACTATGGCAA
TGCAGACAACAGCCCTCGATCCGACCTTCGCCGATGTGGTGAGCTTTGCCACGTCATTGACAGGGGGGCGAAGAG
CTTCAGAGGACGACAGGGCGTCGAGTTTGGAGTGCCTGGGCTTGGTGAATGGGATGATTGAGGTAGGAGAGGGAC
GGCTTGGCCGACGAGCCTGCCTTCAGTGTGGATGTTGCTGACCCTAGTTTACAGTTTATCATTACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail