Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5198
Gene name
LocationContig_468:10848..12483
Strand-
Gene length (bp)1635
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14881 Tubulin_3 Tubulin domain 2.1E-54 128 305
PF10644 Misat_Tub_SegII Misato Segment II tubulin-like domain 1.5E-33 2 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBL8|DML1_GIBZE Protein DML1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DML1 PE=3 SV=1 1 483 5.0E-126
sp|Q7S2Y8|DML1_NEUCR Protein dml-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dml-1 PE=3 SV=2 1 469 2.0E-105
sp|Q2UQJ5|DML1_ASPOR Protein dml1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dml1 PE=3 SV=1 1 483 1.0E-101
sp|Q4WRU4|DML1_ASPFU Protein dml1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dml1 PE=3 SV=1 1 483 2.0E-100
sp|A1D1R1|DML1_NEOFI Protein dml1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dml1 PE=3 SV=1 1 483 4.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBL8|DML1_GIBZE Protein DML1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DML1 PE=3 SV=1 1 483 5.0E-126
sp|Q7S2Y8|DML1_NEUCR Protein dml-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dml-1 PE=3 SV=2 1 469 2.0E-105
sp|Q2UQJ5|DML1_ASPOR Protein dml1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dml1 PE=3 SV=1 1 483 1.0E-101
sp|Q4WRU4|DML1_ASPFU Protein dml1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dml1 PE=3 SV=1 1 483 2.0E-100
sp|A1D1R1|DML1_NEOFI Protein dml1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dml1 PE=3 SV=1 1 483 4.0E-99
sp|A2QAY5|DML1_ASPNC Protein dml1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dml1 PE=3 SV=1 1 483 2.0E-97
sp|A1CNV1|DML1_ASPCL Protein dml1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dml1 PE=3 SV=1 1 483 6.0E-97
sp|Q1E2I3|DML1_COCIM Protein DML1 OS=Coccidioides immitis (strain RS) GN=DML1 PE=3 SV=2 1 482 3.0E-94
sp|Q0V254|DML1_PHANO Protein DML1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DML1 PE=3 SV=2 1 469 3.0E-91
sp|A5D9D4|MSTO1_BOVIN Protein misato homolog 1 OS=Bos taurus GN=MSTO1 PE=2 SV=2 3 325 3.0E-36
sp|Q9BUK6|MSTO1_HUMAN Protein misato homolog 1 OS=Homo sapiens GN=MSTO1 PE=1 SV=1 3 353 2.0E-34
sp|Q5RF82|MSTO1_PONPY Protein misato homolog 1 OS=Pongo pygmaeus GN=MSTO1 PE=2 SV=1 3 353 3.0E-33
sp|Q4R681|MSTO1_MACFA Protein misato homolog 1 OS=Macaca fascicularis GN=MSTO1 PE=2 SV=2 3 325 2.0E-32
sp|Q9P6K5|DML1_SCHPO Protein dml1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dml1 PE=1 SV=1 1 333 6.0E-32
sp|Q2YDW2|MSTO1_MOUSE Protein misato homolog 1 OS=Mus musculus GN=Msto1 PE=1 SV=1 3 325 7.0E-32
sp|Q1L908|MSTO1_DANRE Protein misato homolog 1 OS=Danio rerio GN=msto1 PE=2 SV=1 3 381 3.0E-29
sp|Q6C6D9|DML1_YARLI Protein DML1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DML1 PE=3 SV=1 1 469 1.0E-28
sp|Q5A2W2|DML1_CANAL Protein DML1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DML1 PE=3 SV=1 1 329 8.0E-25
sp|Q6FUF9|DML1_CANGA Protein DML1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DML1 PE=3 SV=1 1 483 2.0E-24
sp|O01939|MST_DROME Protein misato OS=Drosophila melanogaster GN=mst PE=2 SV=1 2 335 3.0E-24
sp|A3LQ44|DML1_PICST Protein DML1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DML1 PE=3 SV=2 1 235 9.0E-23
sp|Q6BL01|DML1_DEBHA Protein DML1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DML1 PE=3 SV=2 1 237 1.0E-20
sp|Q756C7|DML1_ASHGO Protein DML1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DML1 PE=3 SV=1 1 235 6.0E-20
sp|Q6CU61|DML1_KLULA Protein DML1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DML1 PE=3 SV=1 1 266 7.0E-18
sp|Q03652|DML1_YEAST Protein DML1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DML1 PE=1 SV=1 1 234 3.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5198
MHEVVTLQLGNLANYAATHFWNTQESYFTYDDAASSSSSSPPPLVDHNVHWRAGLGHDGTETFLPRTIVYDVKAA
FGSLRQVNALYQQEPGSASDSLWPATSSAVLRQEPVLPNAYMQSLDDGVAELPNLTTAHVRYWSDYLHPHLHPRS
IVSLHDVLLTSEMDRFAAGSHLFSSLDAEHDLVDRDWRPFAEECDLLQGAQVMTALDDAWSGFAASYLEALRDEH
PKMSIWVWALCGSQCDRPQPVMNVANGFSLLFDQASMLVPLCVPDEKDMPHIISLDPSSPWHISALLSTAAECAA
LPSRLRGQPVYLHDMAQSINVAGNQPLASLSMALGSADAAAIDLFPHYPLSSFSRARTSRFPTTFGQFTTIRQTN
NDEQQVPVNTEEPQLSATLVRRCTSKLLCPLLSSFPPIFPQFHDCSAFPVRTVLATSSSISTYIKSLQAQARRYV
GPQEREALTNSLDQIADAYRGEFSYDSDDSFDD*
Coding >OphauG2|5198
ATGCATGAAGTCGTGACTCTGCAGCTCGGCAATCTAGCCAACTATGCAGCTACGCACTTTTGGAATACCCAAGAA
TCCTATTTTACCTACGACGACGCCGCTTCCTCATCCTCATCCTCGCCGCCGCCACTTGTTGATCACAATGTTCAC
TGGCGCGCCGGTCTGGGCCACGATGGCACAGAAACATTTTTGCCTCGGACAATTGTCTATGATGTCAAAGCCGCG
TTTGGCTCTCTCCGCCAGGTGAATGCGCTTTACCAACAAGAACCTGGCTCGGCTTCAGATTCGCTCTGGCCTGCC
ACATCCTCGGCAGTGCTTCGTCAGGAGCCCGTCTTGCCCAATGCCTACATGCAGAGCCTCGATGATGGTGTCGCT
GAGCTACCCAACCTGACGACAGCTCATGTGCGCTACTGGTCCGACTACCTGCATCCTCACTTACACCCAAGATCC
ATTGTGTCGCTTCACGACGTCTTACTCACATCGGAAATGGACCGCTTTGCTGCCGGAAGCCATCTCTTCTCATCG
CTCGACGCCGAACACGACCTTGTCGACCGCGACTGGCGGCCCTTTGCCGAGGAGTGCGATCTGCTGCAAGGCGCT
CAGGTCATGACGGCGCTTGACGATGCTTGGTCTGGCTTTGCCGCCTCATACCTCGAGGCTTTGCGTGACGAGCAT
CCCAAAATGTCCATCTGGGTCTGGGCCTTGTGTGGTTCTCAATGTGACCGCCCTCAACCTGTCATGAATGTCGCC
AATGGTTTCTCTCTGCTCTTCGATCAGGCATCCATGCTTGTACCGCTTTGCGTCCCAGATGAAAAGGACATGCCT
CACATAATTTCACTTGACCCTTCCTCACCCTGGCACATATCTGCCCTACTGTCTACTGCAGCCGAGTGCGCCGCG
CTGCCCTCCCGCCTGAGAGGACAGCCTGTCTATTTGCACGACATGGCACAAAGCATCAATGTTGCTGGAAATCAG
CCTCTAGCTAGCCTTTCTATGGCTCTAGGCTCTGCTGATGCCGCCGCTATCGACCTCTTTCCTCACTATCCTCTC
TCTAGTTTCTCGAGAGCAAGGACTTCGCGTTTTCCTACCACTTTTGGCCAGTTTACCACCATTCGCCAAACCAAC
AATGACGAACAACAAGTCCCTGTAAATACTGAAGAGCCTCAGCTCAGTGCCACTCTTGTCCGTCGATGTACTTCC
AAACTCCTCTGCCCCCTACTAAGTAGCTTTCCACCCATATTCCCCCAGTTCCACGATTGCTCTGCTTTTCCCGTT
CGCACCGTCCTCGCCACCTCCAGTTCCATATCAACCTACATCAAGTCATTACAAGCTCAGGCCCGTCGCTATGTC
GGTCCTCAGGAAAGAGAGGCCTTGACCAACAGCCTTGACCAAATTGCAGACGCCTATCGAGGGGAATTCTCGTAC
GACAGTGATGATAGTTTTGATGACTAA
Transcript >OphauG2|5198
ATGCATGAAGTCGTGACTCTGCAGCTCGGCAATCTAGCCAACTATGCAGCTACGCACTTTTGGAATACCCAAGAA
TCCTATTTTACCTACGACGACGCCGCTTCCTCATCCTCATCCTCGCCGCCGCCACTTGTTGATCACAATGTTCAC
TGGCGCGCCGGTCTGGGCCACGATGGCACAGAAACATTTTTGCCTCGGACAATTGTCTATGATGTCAAAGCCGCG
TTTGGCTCTCTCCGCCAGGTGAATGCGCTTTACCAACAAGAACCTGGCTCGGCTTCAGATTCGCTCTGGCCTGCC
ACATCCTCGGCAGTGCTTCGTCAGGAGCCCGTCTTGCCCAATGCCTACATGCAGAGCCTCGATGATGGTGTCGCT
GAGCTACCCAACCTGACGACAGCTCATGTGCGCTACTGGTCCGACTACCTGCATCCTCACTTACACCCAAGATCC
ATTGTGTCGCTTCACGACGTCTTACTCACATCGGAAATGGACCGCTTTGCTGCCGGAAGCCATCTCTTCTCATCG
CTCGACGCCGAACACGACCTTGTCGACCGCGACTGGCGGCCCTTTGCCGAGGAGTGCGATCTGCTGCAAGGCGCT
CAGGTCATGACGGCGCTTGACGATGCTTGGTCTGGCTTTGCCGCCTCATACCTCGAGGCTTTGCGTGACGAGCAT
CCCAAAATGTCCATCTGGGTCTGGGCCTTGTGTGGTTCTCAATGTGACCGCCCTCAACCTGTCATGAATGTCGCC
AATGGTTTCTCTCTGCTCTTCGATCAGGCATCCATGCTTGTACCGCTTTGCGTCCCAGATGAAAAGGACATGCCT
CACATAATTTCACTTGACCCTTCCTCACCCTGGCACATATCTGCCCTACTGTCTACTGCAGCCGAGTGCGCCGCG
CTGCCCTCCCGCCTGAGAGGACAGCCTGTCTATTTGCACGACATGGCACAAAGCATCAATGTTGCTGGAAATCAG
CCTCTAGCTAGCCTTTCTATGGCTCTAGGCTCTGCTGATGCCGCCGCTATCGACCTCTTTCCTCACTATCCTCTC
TCTAGTTTCTCGAGAGCAAGGACTTCGCGTTTTCCTACCACTTTTGGCCAGTTTACCACCATTCGCCAAACCAAC
AATGACGAACAACAAGTCCCTGTAAATACTGAAGAGCCTCAGCTCAGTGCCACTCTTGTCCGTCGATGTACTTCC
AAACTCCTCTGCCCCCTACTAAGTAGCTTTCCACCCATATTCCCCCAGTTCCACGATTGCTCTGCTTTTCCCGTT
CGCACCGTCCTCGCCACCTCCAGTTCCATATCAACCTACATCAAGTCATTACAAGCTCAGGCCCGTCGCTATGTC
GGTCCTCAGGAAAGAGAGGCCTTGACCAACAGCCTTGACCAAATTGCAGACGCCTATCGAGGGGAATTCTCGTAC
GACAGTGATGATAGTTTTGATGACTAA
Gene >OphauG2|5198
ATGCATGAAGTCGTGACTCTGCAGCTCGGCAATCTAGCCAACTATGCAGCTACGCACTTTTGGAATACCCAAGAA
TCCTATTTTACCTACGACGACGCCGCTTCCTCATCCTCATCCTCGCCGCCGCCACTTGTTGATCACAATGTTCAC
TGGCGCGCCGGTCTGGGCCACGATGGCACAGAAACATTTTTGCCTCGGACAATTGTCTATGATGTCAAAGCCGCG
TTTGGCTCTCTCCGCCAGGTGAATGCGCTTTACCAACAAGAACCTGGCTCGGCTTCAGATTCGCTCTGGTGAGGA
GCATCCGACCGCAACGACAAAGGCAGCCGTGACCTGTATCGTCTTGTGGCTCGTCTCACTCATTGCTCGTGGCTG
ACATGTCGACTTGTCTTGTATCATGTGCTGCCTTCACAGGCCTGCCACATCCTCGGCAGTGCTTCGTCAGGAGCC
CGTCTTGCCCAATGCCTACATGCAGAGCCTCGATGATGGTGTCGCTGAGCTACCCAACCTGACGACAGCTCATGT
GCGCTACTGGTCCGACTACCTGCATCCTCACTTACACCCAAGATCCATTGTGTCGCTTCACGACGTCTTACTCAC
ATCGGAAATGGACCGCTTTGCTGCCGGAAGCCATCTCTTCTCATCGCTCGACGCCGAACACGACCTTGTCGACCG
CGACTGGCGGCCCTTTGCCGAGGAGTGCGATCTGCTGCAAGGCGCTCAGGTCATGACGGCGCTTGACGATGCTTG
GTCTGGCTTTGCCGCCTCATACCTCGAGGCTTTGCGTGACGAGCATCCCAAAATGTCCATCTGGGTCTGGGCCTT
GTGTGGTTCTCAATGTGACCGCCCTCAACCTGTCATGAATGTCGCCAATGGTTTCTCTCTGCTCTTCGATCAGGC
ATCCATGCTTGTACCGCTTTGCGTCCCAGATGAAAAGGACATGCCTCACATAATTTCACTTGACCCTTCCTCACC
CTGGCACATATCTGCCCTACTGTCTACTGCAGCCGAGTGCGCCGCGCTGCCCTCCCGCCTGAGAGGACAGCCTGT
CTATTTGCACGACATGGCACAAAGCATCAATGTTGCTGGAAATCAGCCTCTAGCTAGCCTTTCTATGGCTCTAGG
CTCTGCTGATGCCGCCGCTATCGACCTCTTTCCTCACTATCCTCTCTCTAGTTTCTCGAGAGCAAGGACTTCGCG
TTTTCCTACCACTTTTGGCCAGTTTACCACCATTCGCCAAACCAACAATGACGAACAACAAGTCCCTGTAAATAC
TGAAGAGCCTCAGCTCAGTGCCACTCTTGTCCGTCGGTTAGTTTTGTATGTCTTTTTGCACTCGTGCTTCTATGC
AATCCTAACTGACGTTGTGGTAGATGTACTTCCAAACTCCTCTGCCCCCTACTAAGTAGCTTTCCACCCATATTC
CCCCAGTTCCACGATTGCTCTGCTTTTCCCGTTCGCACCGTCCTCGCCACCTCCAGTTCCATATCAACCTACATC
AAGTCATTACAAGCTCAGGCCCGTCGCTATGTCGGTCCTCAGGAAAGAGAGGCCTTGACCAACAGCCTTGACCAA
ATTGCAGACGCCTATCGAGGGGAATTCTCGTACGACAGTGATGATAGTTTTGATGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail