Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5168
Gene name
LocationContig_462:6879..7809
Strand+
Gene length (bp)930
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 2.9E-44 34 286
PF16113 ECH_2 Enoyl-CoA hydratase/isomerase 4.9E-19 36 188

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4YI89|HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2001 PE=1 SV=1 37 286 5.0E-23
sp|Q52995|ECHH_RHIME Probable enoyl-CoA hydratase OS=Rhizobium meliloti (strain 1021) GN=fadB1 PE=3 SV=2 29 285 2.0E-22
sp|P94549|FADB_BACSU Probable enoyl-CoA hydratase OS=Bacillus subtilis (strain 168) GN=fadB PE=2 SV=1 34 286 2.0E-22
sp|Q49WG8|MENB_STAS1 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menB PE=3 SV=1 34 284 9.0E-20
sp|Q8BH95|ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Echs1 PE=1 SV=1 32 285 9.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4YI89|HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2001 PE=1 SV=1 37 286 5.0E-23
sp|Q52995|ECHH_RHIME Probable enoyl-CoA hydratase OS=Rhizobium meliloti (strain 1021) GN=fadB1 PE=3 SV=2 29 285 2.0E-22
sp|P94549|FADB_BACSU Probable enoyl-CoA hydratase OS=Bacillus subtilis (strain 168) GN=fadB PE=2 SV=1 34 286 2.0E-22
sp|Q49WG8|MENB_STAS1 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menB PE=3 SV=1 34 284 9.0E-20
sp|Q8BH95|ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Echs1 PE=1 SV=1 32 285 9.0E-20
sp|P52046|CRT_CLOAB Short-chain-enoyl-CoA hydratase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=crt PE=1 SV=1 33 283 1.0E-19
sp|P14604|ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus GN=Echs1 PE=1 SV=1 32 285 2.0E-19
sp|Q8CPQ4|MENB_STAES 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menB PE=3 SV=1 34 284 5.0E-19
sp|Q5HQC3|MENB_STAEQ 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menB PE=3 SV=1 34 284 5.0E-19
sp|Q8GB17|CAID_PROSL Carnitinyl-CoA dehydratase OS=Proteus sp. (strain LE138) GN=caiD PE=1 SV=3 24 286 7.0E-19
sp|B4EY26|CAID_PROMH Carnitinyl-CoA dehydratase OS=Proteus mirabilis (strain HI4320) GN=caiD PE=3 SV=1 24 286 7.0E-19
sp|Q4L549|MENB_STAHJ 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menB PE=3 SV=1 34 284 9.0E-19
sp|P44960|MENB_HAEIN 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=menB PE=3 SV=1 34 284 3.0E-18
sp|Q58DM8|ECHM_BOVIN Enoyl-CoA hydratase, mitochondrial OS=Bos taurus GN=ECHS1 PE=2 SV=1 36 285 3.0E-18
sp|O07137|ECHA8_MYCLE Probable enoyl-CoA hydratase echA8 OS=Mycobacterium leprae (strain TN) GN=echA8 PE=3 SV=1 36 284 3.0E-18
sp|B5RGA4|CAID_SALG2 Carnitinyl-CoA dehydratase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=caiD PE=3 SV=1 33 286 4.0E-18
sp|B5R1Q9|CAID_SALEP Carnitinyl-CoA dehydratase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiD PE=3 SV=1 33 286 4.0E-18
sp|B5BL54|CAID_SALPK Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiD PE=3 SV=1 33 286 5.0E-18
sp|C0Q4L2|CAID_SALPC Carnitinyl-CoA dehydratase OS=Salmonella paratyphi C (strain RKS4594) GN=caiD PE=3 SV=1 33 286 5.0E-18
sp|Q5PIL1|CAID_SALPA Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiD PE=3 SV=1 33 286 5.0E-18
sp|Q57TJ1|CAID_SALCH Carnitinyl-CoA dehydratase OS=Salmonella choleraesuis (strain SC-B67) GN=caiD PE=3 SV=1 33 286 5.0E-18
sp|B5F749|CAID_SALA4 Carnitinyl-CoA dehydratase OS=Salmonella agona (strain SL483) GN=caiD PE=3 SV=1 33 286 5.0E-18
sp|Q8ZRX5|CAID_SALTY Carnitinyl-CoA dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiD PE=3 SV=3 33 286 5.0E-18
sp|B4TWR3|CAID_SALSV Carnitinyl-CoA dehydratase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiD PE=3 SV=1 33 286 5.0E-18
sp|B4TIG9|CAID_SALHS Carnitinyl-CoA dehydratase OS=Salmonella heidelberg (strain SL476) GN=caiD PE=3 SV=1 33 286 5.0E-18
sp|Q8Z9L5|CAID_SALTI Carnitinyl-CoA dehydratase OS=Salmonella typhi GN=caiD PE=3 SV=3 33 286 5.0E-18
sp|A9MYJ5|CAID_SALPB Carnitinyl-CoA dehydratase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiD PE=3 SV=1 33 286 6.0E-18
sp|B5FHG4|CAID_SALDC Carnitinyl-CoA dehydratase OS=Salmonella dublin (strain CT_02021853) GN=caiD PE=3 SV=1 33 286 6.0E-18
sp|B4T6J5|CAID_SALNS Carnitinyl-CoA dehydratase OS=Salmonella newport (strain SL254) GN=caiD PE=3 SV=1 33 286 7.0E-18
sp|Q5R646|ECHM_PONAB Enoyl-CoA hydratase, mitochondrial OS=Pongo abelii GN=ECHS1 PE=2 SV=1 36 285 8.0E-18
sp|O34893|YNGF_BACSU Putative enoyl-CoA hydratase/isomerase YngF OS=Bacillus subtilis (strain 168) GN=yngF PE=3 SV=1 34 286 1.0E-17
sp|Q7U004|ECH12_MYCBO Probable enoyl-CoA hydratase echA12 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA12 PE=3 SV=1 34 284 1.0E-17
sp|P53526|ECH12_MYCLE Probable enoyl-CoA hydratase echA12 OS=Mycobacterium leprae (strain TN) GN=echA12 PE=3 SV=1 34 266 1.0E-17
sp|P76082|PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) GN=paaF PE=1 SV=1 34 286 2.0E-17
sp|Q9TM10|MENB_CYACA 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Cyanidium caldarium GN=menB PE=3 SV=1 39 284 2.0E-17
sp|P9WNN7|ECH12_MYCTU Probable enoyl-CoA hydratase echA12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA12 PE=1 SV=1 34 284 2.0E-17
sp|P9WNN6|ECH12_MYCTO Probable enoyl-CoA hydratase echA12 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA12 PE=3 SV=1 34 284 2.0E-17
sp|Q7A6A9|MENB_STAAN 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain N315) GN=menB PE=1 SV=1 34 284 2.0E-17
sp|Q99V48|MENB_STAAM 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menB PE=3 SV=1 34 284 2.0E-17
sp|Q7CQ56|MENB_SALTY 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=menB PE=1 SV=1 34 284 2.0E-17
sp|Q9CLV5|MENB_PASMU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Pasteurella multocida (strain Pm70) GN=menB PE=3 SV=1 30 284 2.0E-17
sp|P9WNN9|ECHA8_MYCTU Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA8 PE=1 SV=1 34 284 3.0E-17
sp|P9WNN8|ECHA8_MYCTO Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA8 PE=3 SV=1 34 284 3.0E-17
sp|P64017|ECHA8_MYCBO Probable enoyl-CoA hydratase echA8 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA8 PE=3 SV=1 34 284 3.0E-17
sp|Q1ZXF1|ECHM_DICDI Probable enoyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=echs1 PE=3 SV=1 36 284 5.0E-17
sp|Q8NXA0|MENB_STAAW 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MW2) GN=menB PE=3 SV=1 34 284 6.0E-17
sp|Q6GAG7|MENB_STAAS 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MSSA476) GN=menB PE=3 SV=1 34 284 6.0E-17
sp|P30084|ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=ECHS1 PE=1 SV=4 36 285 7.0E-17
sp|Q6GI37|MENB_STAAR 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MRSA252) GN=menB PE=3 SV=1 34 284 8.0E-17
sp|Q5HH38|MENB_STAAC 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain COL) GN=menB PE=1 SV=1 34 284 8.0E-17
sp|A9MR28|CAID_SALAR Carnitinyl-CoA dehydratase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiD PE=3 SV=1 33 286 1.0E-16
sp|P23966|MENB_BACSU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Bacillus subtilis (strain 168) GN=menB PE=1 SV=2 30 284 2.0E-16
sp|A8ALR7|CAID_CITK8 Carnitinyl-CoA dehydratase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiD PE=3 SV=1 33 286 2.0E-16
sp|P0ABU0|MENB_ECOLI 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli (strain K12) GN=menB PE=1 SV=1 34 284 3.0E-16
sp|P0ABU1|MENB_ECOL6 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=menB PE=3 SV=1 34 284 3.0E-16
sp|Q869N6|CRTL_DICDI 3-hydroxybutyryl-CoA dehydratase-like protein, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0271866 PE=3 SV=1 32 282 3.0E-16
sp|P34559|ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans GN=ech-6 PE=3 SV=1 34 285 8.0E-16
sp|O35459|ECH1_MOUSE Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus GN=Ech1 PE=1 SV=1 22 280 1.0E-15
sp|Q62651|ECH1_RAT Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Rattus norvegicus GN=Ech1 PE=1 SV=2 22 280 6.0E-15
sp|P59395|CAID_SHIFL Carnitinyl-CoA dehydratase OS=Shigella flexneri GN=caiD PE=3 SV=2 34 286 9.0E-15
sp|P31551|CAID_ECOLI Carnitinyl-CoA dehydratase OS=Escherichia coli (strain K12) GN=caiD PE=1 SV=4 34 286 1.0E-14
sp|B1IRE0|CAID_ECOLC Carnitinyl-CoA dehydratase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiD PE=3 SV=1 34 286 1.0E-14
sp|Q8FLA6|CAID_ECOL6 Carnitinyl-CoA dehydratase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiD PE=3 SV=3 34 286 1.0E-14
sp|Q0TLV3|CAID_ECOL5 Carnitinyl-CoA dehydratase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiD PE=3 SV=1 34 286 1.0E-14
sp|B1LFW9|CAID_ECOSM Carnitinyl-CoA dehydratase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiD PE=3 SV=1 34 286 2.0E-14
sp|P77467|PAAG_ECOLI 1,2-epoxyphenylacetyl-CoA isomerase OS=Escherichia coli (strain K12) GN=paaG PE=1 SV=1 34 286 2.0E-14
sp|Q8XA35|CAID_ECO57 Carnitinyl-CoA dehydratase OS=Escherichia coli O157:H7 GN=caiD PE=3 SV=3 34 286 2.0E-14
sp|Q8GYN9|MENB_ARATH 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal OS=Arabidopsis thaliana GN=MENB PE=1 SV=2 34 284 3.0E-14
sp|Q3TLP5|ECHD2_MOUSE Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus GN=Echdc2 PE=1 SV=2 34 286 4.0E-14
sp|P41942|YKB4_CAEEL Uncharacterized protein B0272.4 OS=Caenorhabditis elegans GN=B0272.4 PE=3 SV=1 34 210 8.0E-14
sp|P9WNP1|ECHA6_MYCTU Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA6 PE=1 SV=1 34 286 1.0E-13
sp|P9WNP0|ECHA6_MYCTO Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA6 PE=3 SV=1 34 286 1.0E-13
sp|P64015|ECHA6_MYCBO Probable enoyl-CoA hydratase echA6 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA6 PE=3 SV=1 34 286 1.0E-13
sp|Q8DSN0|FABM_STRMU Trans-2-decenoyl-[acyl-carrier-protein] isomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fabM PE=3 SV=1 39 286 3.0E-13
sp|Q50130|ECHA6_MYCLE Probable enoyl-CoA hydratase echA6 OS=Mycobacterium leprae (strain TN) GN=echA6 PE=3 SV=1 34 286 1.0E-12
sp|Q13011|ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens GN=ECH1 PE=1 SV=2 7 268 2.0E-12
sp|C3K613|FADB_PSEFS Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain SBW25) GN=fadB PE=3 SV=1 41 250 3.0E-12
sp|Q4KFC4|FADB_PSEF5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fadB PE=3 SV=1 36 228 3.0E-12
sp|P40802|PKSI_BACSU Putative polyketide biosynthesis enoyl-CoA isomerase PksI OS=Bacillus subtilis (strain 168) GN=pksI PE=1 SV=2 32 226 4.0E-12
sp|O85078|CBAD1_ARTSP 4-chlorobenzoyl coenzyme A dehalogenase-1 OS=Arthrobacter sp. GN=fcbB1 PE=1 SV=2 24 186 6.0E-12
sp|A5JTM5|CBADH_PSEUC 4-chlorobenzoyl coenzyme A dehalogenase OS=Pseudomonas sp. (strain CBS-3) PE=1 SV=1 37 228 6.0E-12
sp|Q9LCU3|CBAD2_ARTSP 4-chlorobenzoyl coenzyme A dehalogenase-2 OS=Arthrobacter sp. GN=fcbB2 PE=1 SV=1 24 186 7.0E-12
sp|A9JS71|ECHD3_XENLA Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Xenopus laevis GN=echdc3 PE=2 SV=1 32 282 7.0E-12
sp|Q86YB7|ECHD2_HUMAN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Homo sapiens GN=ECHDC2 PE=1 SV=2 34 286 7.0E-12
sp|Q3MIE0|ECHD3_RAT Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Rattus norvegicus GN=Echdc3 PE=2 SV=1 25 282 8.0E-12
sp|Q5RFG0|ECH1_PONAB Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Pongo abelii GN=ECH1 PE=2 SV=1 34 268 8.0E-12
sp|Q73VC7|ECH17_MYCPA Probable enoyl-CoA hydratase echA17 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=echA17 PE=3 SV=1 34 264 1.0E-11
sp|Q9HZJ2|FADB_PSEAE Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fadB PE=3 SV=1 24 229 1.0E-11
sp|Q02PH8|FADB_PSEAB Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fadB PE=3 SV=1 24 229 1.0E-11
sp|B7UYR6|FADB_PSEA8 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain LESB58) GN=fadB PE=3 SV=1 24 229 1.0E-11
sp|P24162|ECHH_RHOCB Probable enoyl-CoA hydratase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=fadB1 PE=3 SV=1 34 286 2.0E-11
sp|Q2TBT3|ECHD2_BOVIN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1 34 286 2.0E-11
sp|A6V382|FADB_PSEA7 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain PA7) GN=fadB PE=3 SV=1 24 229 2.0E-11
sp|P9WNN3|ECH17_MYCTU Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA17 PE=1 SV=1 34 223 2.0E-11
sp|P9WNN2|ECH17_MYCTO Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA17 PE=3 SV=1 34 223 2.0E-11
sp|A5U753|ECH17_MYCTA Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=echA17 PE=3 SV=1 34 223 2.0E-11
sp|A1KN36|ECH17_MYCBP Probable enoyl-CoA hydratase echA17 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=echA17 PE=3 SV=1 34 223 2.0E-11
sp|Q7TXE1|ECH17_MYCBO Probable enoyl-CoA hydratase echA17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA17 PE=1 SV=1 34 223 2.0E-11
sp|O87872|BAMA_THAAR 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase OS=Thauera aromatica GN=oah PE=1 SV=1 18 229 2.0E-11
sp|Q9D7J9|ECHD3_MOUSE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Mus musculus GN=Echdc3 PE=1 SV=1 37 282 3.0E-11
sp|A0QJH8|ECH17_MYCA1 Probable enoyl-CoA hydratase echA17 OS=Mycobacterium avium (strain 104) GN=echA17 PE=3 SV=1 34 246 3.0E-11
sp|Q96DC8|ECHD3_HUMAN Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Homo sapiens GN=ECHDC3 PE=1 SV=2 24 282 4.0E-11
sp|Q87ZB2|FADB_PSESM Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fadB PE=3 SV=1 36 228 5.0E-11
sp|A4VKA3|FADB_PSEU5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas stutzeri (strain A1501) GN=fadB PE=3 SV=1 36 250 7.0E-11
sp|Q4ZRA0|FADB_PSEU2 Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fadB PE=3 SV=1 36 228 1.0E-10
sp|Q3K9D8|FADB_PSEPF Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf0-1) GN=fadB PE=3 SV=1 41 222 2.0E-10
sp|Q9WUR2|ECI2_MOUSE Enoyl-CoA delta isomerase 2, mitochondrial OS=Mus musculus GN=Eci2 PE=1 SV=2 34 282 2.0E-10
sp|Q48GW3|FADB_PSE14 Fatty acid oxidation complex subunit alpha OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fadB PE=3 SV=1 36 228 3.0E-10
sp|Q39TV7|BAMA_GEOMG 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=bamA PE=1 SV=1 39 264 3.0E-10
sp|Q1I7D4|FADB_PSEE4 Fatty acid oxidation complex subunit alpha OS=Pseudomonas entomophila (strain L48) GN=fadB PE=3 SV=1 41 220 5.0E-10
sp|B0KH74|FADB_PSEPG Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain GB-1) GN=fadB PE=3 SV=1 41 250 7.0E-10
sp|Q13825|AUHM_HUMAN Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=AUH PE=1 SV=1 34 286 8.0E-10
sp|Q5ZJ60|HIBCH_CHICK 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Gallus gallus GN=HIBCH PE=2 SV=1 36 203 9.0E-10
sp|Q6LW06|FADB_PHOPR Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadB PE=3 SV=1 34 228 9.0E-10
sp|Q54HG7|AUHM_DICDI Methylglutaconyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=auh PE=3 SV=1 34 286 9.0E-10
sp|Q9JLZ3|AUHM_MOUSE Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Auh PE=1 SV=1 34 286 9.0E-10
sp|A8GYG0|FADB_SHEPA Fatty acid oxidation complex subunit alpha OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fadB PE=3 SV=1 44 227 1.0E-09
sp|A5W6H0|FADB_PSEP1 Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fadB PE=3 SV=1 41 250 2.0E-09
sp|B0TLB9|FADB_SHEHH Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadB PE=3 SV=1 44 229 3.0E-09
sp|P28793|FADB_PSEFR Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi GN=fadB PE=1 SV=1 24 250 3.0E-09
sp|Q2LXU2|BAMA_SYNAS 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase OS=Syntrophus aciditrophicus (strain SB) GN=bamA PE=1 SV=1 36 252 4.0E-09
sp|Q5XIC0|ECI2_RAT Enoyl-CoA delta isomerase 2, mitochondrial OS=Rattus norvegicus GN=Eci2 PE=1 SV=1 34 209 4.0E-09
sp|Q88L02|FADB_PSEPK Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain KT2440) GN=fadB PE=3 SV=1 41 250 4.0E-09
sp|Q93Q12|FADB_PSEOL Fatty acid oxidation complex subunit alpha OS=Pseudomonas oleovorans GN=fadB PE=3 SV=1 41 250 5.0E-09
sp|B1J5A5|FADB_PSEPW Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain W619) GN=fadB PE=3 SV=1 41 250 5.0E-09
sp|Q54SS0|ECH1_DICDI Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Dictyostelium discoideum GN=ech1 PE=3 SV=1 39 288 5.0E-09
sp|Q9AHY3|FADB_PSEPU Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida GN=fadB PE=3 SV=2 41 250 8.0E-09
sp|P52045|SCPB_ECOLI Methylmalonyl-CoA decarboxylase OS=Escherichia coli (strain K12) GN=scpB PE=1 SV=1 30 286 9.0E-09
sp|A1RDW6|FADB_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadB PE=3 SV=1 39 228 1.0E-08
sp|A4Y1B6|FADB_SHEPC Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadB PE=3 SV=1 39 228 1.0E-08
sp|A6WHA0|FADB_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadB PE=3 SV=1 39 229 1.0E-08
sp|A3CYJ4|FADB_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadB PE=3 SV=1 39 229 1.0E-08
sp|B8E3R3|FADB_SHEB2 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS223) GN=fadB PE=3 SV=1 39 229 1.0E-08
sp|B0VLX4|FADB_ACIBS Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain SDF) GN=fadB PE=3 SV=1 44 228 2.0E-08
sp|B2I2J9|FADB_ACIBC Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain ACICU) GN=fadB PE=3 SV=1 44 228 2.0E-08
sp|B0VE45|FADB_ACIBY Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AYE) GN=fadB PE=3 SV=1 44 228 2.0E-08
sp|B7I3P1|FADB_ACIB5 Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB0057) GN=fadB PE=3 SV=1 44 228 2.0E-08
sp|B7H1I0|FADB_ACIB3 Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB307-0294) GN=fadB PE=3 SV=1 44 228 2.0E-08
sp|A9KU91|FADB_SHEB9 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS195) GN=fadB PE=3 SV=1 39 229 2.0E-08
sp|A1JIG4|FADB_YERE8 Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadB PE=3 SV=1 126 227 3.0E-08
sp|A4XSM8|FADB_PSEMY Fatty acid oxidation complex subunit alpha OS=Pseudomonas mendocina (strain ymp) GN=fadB PE=3 SV=1 36 250 4.0E-08
sp|P28817|HIBCH_YEAST 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHD3 PE=1 SV=2 36 180 7.0E-08
sp|A2VDC2|HIBCH_XENLA 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus laevis GN=hibch PE=2 SV=1 36 181 7.0E-08
sp|Q6NYL3|ECHP_DANRE Peroxisomal bifunctional enzyme OS=Danio rerio GN=ehhadh PE=2 SV=1 34 222 7.0E-08
sp|A8G8D1|FADB_SERP5 Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadB PE=3 SV=1 126 227 9.0E-08
sp|A0KEL1|FADB_AERHH Fatty acid oxidation complex subunit alpha OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadB PE=3 SV=1 34 227 1.0E-07
sp|Q8BMS1|ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus GN=Hadha PE=1 SV=1 34 256 1.0E-07
sp|Q1Q8J9|FADB_PSYCK Fatty acid oxidation complex subunit alpha OS=Psychrobacter cryohalolentis (strain K5) GN=fadB PE=3 SV=1 44 229 2.0E-07
sp|Q8EKR9|FADB_SHEON Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadB PE=3 SV=1 39 229 2.0E-07
sp|Q5R5M8|ECHP_PONAB Peroxisomal bifunctional enzyme OS=Pongo abelii GN=EHHADH PE=2 SV=1 34 215 2.0E-07
sp|O75521|ECI2_HUMAN Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens GN=ECI2 PE=1 SV=4 34 280 3.0E-07
sp|A7FDF2|FADB_YERP3 Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadB PE=3 SV=1 126 227 3.0E-07
sp|B1JP63|FADB_YERPY Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fadB PE=3 SV=1 126 227 4.0E-07
sp|A4TR27|FADB_YERPP Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadB PE=3 SV=1 126 227 4.0E-07
sp|Q1CN99|FADB_YERPN Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadB PE=3 SV=1 126 227 4.0E-07
sp|A9R754|FADB_YERPG Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fadB PE=3 SV=1 126 227 4.0E-07
sp|Q8ZAN0|FADB_YERPE Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadB PE=3 SV=1 126 227 4.0E-07
sp|Q1C2C4|FADB_YERPA Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadB PE=3 SV=1 126 227 4.0E-07
sp|Q66FR8|FADB_YERPS Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadB PE=3 SV=1 126 227 4.0E-07
sp|B2K0Z6|FADB_YERPB Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fadB PE=3 SV=1 126 227 4.0E-07
sp|Q5XIE6|HIBCH_RAT 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Rattus norvegicus GN=Hibch PE=1 SV=2 7 201 4.0E-07
sp|A4STF2|FADB_AERS4 Fatty acid oxidation complex subunit alpha OS=Aeromonas salmonicida (strain A449) GN=fadB PE=3 SV=1 34 229 4.0E-07
sp|Q7MZ92|FADB_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadB PE=3 SV=1 126 228 5.0E-07
sp|Q9L6L5|FADB_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadB PE=3 SV=1 126 259 5.0E-07
sp|Q08426|ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3 34 215 5.0E-07
sp|B5RFL6|FADB_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadB PE=3 SV=1 126 259 5.0E-07
sp|B5QW85|FADB_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadB PE=3 SV=1 126 259 5.0E-07
sp|B5EZW0|FADB_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadB PE=3 SV=1 126 259 5.0E-07
sp|A9MYB0|FADB_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadB PE=3 SV=1 126 259 5.0E-07
sp|Q57HM6|FADB_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadB PE=3 SV=2 126 259 5.0E-07
sp|Q8Z3C6|FADB_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadB PE=3 SV=1 126 259 5.0E-07
sp|B5BIZ0|FADB_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadB PE=3 SV=1 126 259 5.0E-07
sp|Q5PKQ2|FADB_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadB PE=3 SV=1 126 259 5.0E-07
sp|Q58EB4|HIBCH_DANRE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Danio rerio GN=hibch PE=2 SV=1 36 181 6.0E-07
sp|B8CH91|FADB_SHEPW Fatty acid oxidation complex subunit alpha OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fadB PE=3 SV=1 44 229 7.0E-07
sp|Q64428|ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus GN=Hadha PE=1 SV=2 34 286 7.0E-07
sp|Q4FQC6|FADB_PSYA2 Fatty acid oxidation complex subunit alpha OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fadB PE=3 SV=1 44 228 8.0E-07
sp|Q0I0T3|FADB_SHESR Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadB PE=3 SV=1 39 229 9.0E-07
sp|Q0HPB7|FADB_SHESM Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadB PE=3 SV=1 39 229 1.0E-06
sp|A0KR50|FADB_SHESA Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadB PE=3 SV=1 39 229 1.0E-06
sp|P9WNN5|ECH14_MYCTU Probable enoyl-CoA hydratase echA14 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA14 PE=1 SV=1 34 181 1.0E-06
sp|P9WNN4|ECH14_MYCTO Probable enoyl-CoA hydratase echA14 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA14 PE=3 SV=1 34 181 1.0E-06
sp|P64019|ECH14_MYCBO Probable enoyl-CoA hydratase echA14 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA14 PE=1 SV=1 34 181 1.0E-06
sp|B4SZ85|FADB_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadB PE=3 SV=1 126 259 1.0E-06
sp|A0QRD3|MENB_MYCS2 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=menB PE=1 SV=1 33 284 2.0E-06
sp|B1KCZ3|FADB_SHEWM Fatty acid oxidation complex subunit alpha OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fadB PE=3 SV=1 44 228 2.0E-06
sp|A3Q8U4|FADB_SHELP Fatty acid oxidation complex subunit alpha OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadB PE=3 SV=1 44 228 2.0E-06
sp|Q83PG1|FADB_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadB PE=3 SV=4 126 259 2.0E-06
sp|Q0SZ36|FADB_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadB PE=3 SV=1 126 259 2.0E-06
sp|A7MQP0|FADB_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadB PE=3 SV=1 126 227 2.0E-06
sp|P45361|CRT_PEPDI Short-chain-enoyl-CoA hydratase (Fragment) OS=Peptoclostridium difficile GN=crt PE=3 SV=1 125 276 2.0E-06
sp|C3LSI3|FADB_VIBCM Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain M66-2) GN=fadB PE=3 SV=1 42 220 3.0E-06
sp|Q9KNI1|FADB_VIBCH Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadB PE=3 SV=1 42 220 3.0E-06
sp|A5F465|FADB_VIBC3 Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadB PE=3 SV=1 42 220 3.0E-06
sp|B5XYH0|FADB_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadB PE=3 SV=1 126 227 3.0E-06
sp|P9WNP5|MENB_MYCTU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menB PE=1 SV=1 35 284 3.0E-06
sp|P9WNP4|MENB_MYCTO 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menB PE=3 SV=1 35 284 3.0E-06
sp|Q6DAP5|FADB_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadB PE=3 SV=1 126 227 4.0E-06
sp|Q9Y6F8|CDY1_HUMAN Testis-specific chromodomain protein Y 1 OS=Homo sapiens GN=CDY1 PE=1 SV=1 32 209 4.0E-06
sp|Q5LLW6|DMDD_RUEPO Methylthioacryloyl-CoA hydratase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdD PE=1 SV=1 34 235 4.0E-06
sp|Q9Y6F7|CDY2_HUMAN Testis-specific chromodomain protein Y 2 OS=Homo sapiens GN=CDY2A PE=1 SV=1 32 209 5.0E-06
sp|Q28FR6|HIBCH_XENTR 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus tropicalis GN=hibch PE=2 SV=1 36 181 6.0E-06
sp|Q5QXM1|FADJ_IDILO Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadJ PE=3 SV=1 45 307 6.0E-06
sp|P55100|ECHP_CAVPO Peroxisomal bifunctional enzyme OS=Cavia porcellus GN=EHHADH PE=2 SV=2 34 210 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5290
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5168 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6089
Ophiocordyceps camponoti-floridani Ophcf2|02356
Ophiocordyceps camponoti-rufipedis Ophun1|699
Ophiocordyceps kimflemingae Ophio5|4884
Ophiocordyceps subramaniannii Hirsu2|4732

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5168
MSSEHPLPNSYSQLSLGGIRFAHHPASSPTVTPIVLVQLHRPPSRNAFTHEMGQSLVTAFNLLSADDRVRVVILT
SSDESNKMFCVGMDLKEGGPAGPSLEGPRANTDYRDMGGRVSLAIYRCNKPVIAAINGTAVGIGITMTLPATIRI
ASRDAKIGFVFARRGFTMEACSSFFLPRLIGASRALHLTSVATPYPASHDLLKHLFSQVVAPDQVLPCALAIAED
MIANVSLVAASLIKDMIYRAPASPEEAHLLESKLFLSLFLSQDAQEGRESFLQKRKPDFKGTMADAPASYPWWAP
VDVKPKSHL*
Coding >OphauG2|5168
ATGTCGTCTGAGCACCCGCTGCCCAATAGCTATTCCCAGCTCTCTCTTGGTGGGATTCGCTTCGCTCACCACCCA
GCGTCCTCGCCAACAGTCACACCAATAGTCCTTGTCCAGCTTCACCGCCCCCCCAGTCGCAATGCTTTTACTCAT
GAAATGGGCCAGTCCCTCGTCACCGCCTTCAATCTCCTCTCCGCCGATGACCGAGTCCGCGTCGTTATCCTCACG
TCGTCTGATGAGTCCAACAAAATGTTTTGCGTCGGCATGGACCTCAAAGAGGGCGGCCCTGCTGGCCCCAGCCTC
GAGGGACCGCGTGCCAATACCGATTATCGCGACATGGGTGGACGCGTTTCACTGGCAATCTACCGCTGCAACAAG
CCCGTCATCGCCGCCATCAATGGCACCGCAGTCGGCATCGGCATCACAATGACTCTCCCCGCCACCATCCGCATT
GCCAGCCGCGATGCAAAGATTGGCTTCGTGTTTGCCCGCCGTGGCTTCACCATGGAGGCTTGCAGCAGCTTCTTC
CTGCCTCGTCTGATTGGTGCCAGCCGCGCCCTACATCTCACTTCTGTCGCCACCCCATACCCGGCATCACATGAC
CTACTCAAGCATCTTTTTAGCCAAGTGGTCGCCCCTGACCAAGTCTTGCCGTGTGCCCTCGCCATTGCCGAGGAC
ATGATTGCCAATGTCAGTCTTGTGGCCGCTTCCCTCATCAAGGACATGATATATCGCGCACCAGCCTCGCCCGAG
GAAGCCCATTTGCTTGAAAGCAAGCTCTTTCTCTCTCTCTTCCTCAGCCAAGACGCCCAGGAGGGCCGGGAGAGC
TTTTTGCAGAAAAGAAAACCCGATTTCAAGGGCACAATGGCTGACGCGCCTGCGTCTTATCCGTGGTGGGCGCCT
GTTGATGTGAAGCCCAAGTCTCACCTCTGA
Transcript >OphauG2|5168
ATGTCGTCTGAGCACCCGCTGCCCAATAGCTATTCCCAGCTCTCTCTTGGTGGGATTCGCTTCGCTCACCACCCA
GCGTCCTCGCCAACAGTCACACCAATAGTCCTTGTCCAGCTTCACCGCCCCCCCAGTCGCAATGCTTTTACTCAT
GAAATGGGCCAGTCCCTCGTCACCGCCTTCAATCTCCTCTCCGCCGATGACCGAGTCCGCGTCGTTATCCTCACG
TCGTCTGATGAGTCCAACAAAATGTTTTGCGTCGGCATGGACCTCAAAGAGGGCGGCCCTGCTGGCCCCAGCCTC
GAGGGACCGCGTGCCAATACCGATTATCGCGACATGGGTGGACGCGTTTCACTGGCAATCTACCGCTGCAACAAG
CCCGTCATCGCCGCCATCAATGGCACCGCAGTCGGCATCGGCATCACAATGACTCTCCCCGCCACCATCCGCATT
GCCAGCCGCGATGCAAAGATTGGCTTCGTGTTTGCCCGCCGTGGCTTCACCATGGAGGCTTGCAGCAGCTTCTTC
CTGCCTCGTCTGATTGGTGCCAGCCGCGCCCTACATCTCACTTCTGTCGCCACCCCATACCCGGCATCACATGAC
CTACTCAAGCATCTTTTTAGCCAAGTGGTCGCCCCTGACCAAGTCTTGCCGTGTGCCCTCGCCATTGCCGAGGAC
ATGATTGCCAATGTCAGTCTTGTGGCCGCTTCCCTCATCAAGGACATGATATATCGCGCACCAGCCTCGCCCGAG
GAAGCCCATTTGCTTGAAAGCAAGCTCTTTCTCTCTCTCTTCCTCAGCCAAGACGCCCAGGAGGGCCGGGAGAGC
TTTTTGCAGAAAAGAAAACCCGATTTCAAGGGCACAATGGCTGACGCGCCTGCGTCTTATCCGTGGTGGGCGCCT
GTTGATGTGAAGCCCAAGTCTCACCTCTGA
Gene >OphauG2|5168
ATGTCGTCTGAGCACCCGCTGCCCAATAGCTATTCCCAGCTCTCTCTTGGTGGGATTCGCTTCGCTCACCACCCA
GCGTCCTCGCCAACAGTCACACCAATAGTCCTTGTCCAGCTTCACCGCCCCCCCAGTCGCAATGCTTTTACTCAT
GAAATGGGCCAGTCCCTCGTCACCGCCTTCAATCTCCTCTCCGCCGATGACCGAGTCCGCGTCGTTATCCTCACG
TCGTCTGATGAGTCCAACAAAATGTTTTGCGTCGGCATGGACCTCAAAGAGGGCGGCCCTGCTGGCCCCAGCCTC
GAGGGACCGCGTGCCAATACCGATTATCGCGACATGGGTGGACGCGTTTCACTGGCAATCTACCGCTGCAACAAG
CCCGTCATCGCCGCCATCAATGGCACCGCAGTCGGCATCGGCATCACAATGACTCTCCCCGCCACCATCCGCATT
GCCAGCCGCGATGCAAAGATTGGCTTCGTGTTTGCCCGCCGTGGCTTCACCATGGAGGCTTGCAGCAGCTTCTTC
CTGCCTCGTCTGATTGGTGCCAGCCGCGCCCTACATCTCACTTCTGTCGCCACCCCATACCCGGCATCACATGAC
CTACTCAAGCATCTTTTTAGCCAAGTGGTCGCCCCTGACCAAGTCTTGCCGTGTGCCCTCGCCATTGCCGAGGAC
ATGATTGCCAATGTCAGTCTTGTGGCCGCTTCCCTCATCAAGGACATGATATATCGCGCACCAGCCTCGCCCGAG
GAAGCCCATTTGCTTGAAAGCAAGCTCTTTCTCTCTCTCTTCCTCAGCCAAGACGCCCAGGAGGGCCGGGAGAGC
TTTTTGCAGAAAAGAAAACCCGATTTCAAGGGCACAATGGCTGACGCGCCTGCGTCTTATCCGTGGTGGGCGCCT
GTTGATGTGAAGCCCAAGTCTCACCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail