Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5166
Gene name
LocationContig_462:1535..3141
Strand-
Gene length (bp)1606
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03676 PHAF1 Phagosome assembly factor 1 5.1E-36 15 286
PF03676 PHAF1 Phagosome assembly factor 1 1.7E-17 381 515

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SD33|U183_ARATH UPF0183 protein At3g51130 OS=Arabidopsis thaliana GN=At3g51130 PE=2 SV=2 8 515 2.0E-27
sp|O08654|CP070_RAT UPF0183 protein C16orf70 homolog OS=Rattus norvegicus PE=2 SV=1 10 515 8.0E-18
sp|Q9BSU1|CP070_HUMAN UPF0183 protein C16orf70 OS=Homo sapiens GN=C16orf70 PE=1 SV=1 10 515 1.0E-17
sp|P34692|U183_CAEEL UPF0183 protein T01G9.2 OS=Caenorhabditis elegans GN=T01G9.2 PE=1 SV=3 17 429 4.0E-17
sp|Q922R1|CP070_MOUSE UPF0183 protein C16orf70 homolog OS=Mus musculus PE=1 SV=2 10 515 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SD33|U183_ARATH UPF0183 protein At3g51130 OS=Arabidopsis thaliana GN=At3g51130 PE=2 SV=2 8 515 2.0E-27
sp|O08654|CP070_RAT UPF0183 protein C16orf70 homolog OS=Rattus norvegicus PE=2 SV=1 10 515 8.0E-18
sp|Q9BSU1|CP070_HUMAN UPF0183 protein C16orf70 OS=Homo sapiens GN=C16orf70 PE=1 SV=1 10 515 1.0E-17
sp|P34692|U183_CAEEL UPF0183 protein T01G9.2 OS=Caenorhabditis elegans GN=T01G9.2 PE=1 SV=3 17 429 4.0E-17
sp|Q922R1|CP070_MOUSE UPF0183 protein C16orf70 homolog OS=Mus musculus PE=1 SV=2 10 515 1.0E-16
sp|Q9VSH9|U183_DROME UPF0183 protein CG7083 OS=Drosophila melanogaster GN=CG7083 PE=2 SV=1 17 407 3.0E-14
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4387
Ophiocordyceps australis 1348a (Ghana) OphauG2|5166 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6091
Ophiocordyceps australis map64 (Brazil) OphauB2|6092
Ophiocordyceps australis map64 (Brazil) OphauB2|6093
Ophiocordyceps australis map64 (Brazil) OphauB2|87
Ophiocordyceps camponoti-floridani Ophcf2|02677
Ophiocordyceps camponoti-rufipedis Ophun1|4371
Ophiocordyceps kimflemingae Ophio5|2062
Ophiocordyceps kimflemingae Ophio5|4888
Ophiocordyceps kimflemingae Ophio5|8395
Ophiocordyceps subramaniannii Hirsu2|5226
Ophiocordyceps subramaniannii Hirsu2|9012

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5166
MTLYTAQLHPGRAIGFFVLGASLHEILTRIKAEPNLFPKMELLFSHDRPLHEAVSIALPQNGFRLRFDGPEQRLR
LIEVTDFTKNHITFKDRDLLKPPSATSQMSGSSPSRESGPSFRHIYNRLLGPTYPGEFIPPEKDGQDGIYVLSYP
GVAFNFALAKEAYSPEIDVVSQFAAMSSQLAKSMAIFSGDSWAVARPTLWTAALPSIKTTSVVPRAKDVYSDEIS
LVRLYGGGKIDVLRKWTNNGFRIQLGETTPQELVMELGPPNAIYYKNDQRMMVHKMHSKTTGRGQVVATDQSRTE
DLTDTDQSSLHTGSEGSDAEDSVDEDLTSNLSGECFFNYFYQGFDILLSSPQQPACAPPGTVSNTASTGKAYKSY
QSEQLVANKLVLHGNIPGSYEFNRHRRCRWEIDTSDKDGEQAQGINSETHFTEIEQEMKRQWASCFERHQSNRVV
KGMALNRGWGDSPEDSCELVGGWEETRPKKTQSDGDLETTTTLYGFPGMVFEVLKNGYVNTLTVY*
Coding >OphauG2|5166
ATGACGCTTTACACGGCGCAACTCCATCCCGGACGGGCAATTGGCTTCTTTGTGCTTGGCGCCTCGTTGCACGAG
ATACTGACACGCATCAAGGCCGAGCCAAATTTGTTTCCCAAGATGGAGCTCCTGTTTTCCCACGACCGTCCGCTA
CACGAAGCCGTGTCTATAGCCCTGCCGCAAAATGGATTCCGGCTGCGCTTTGATGGCCCGGAGCAGCGTTTGCGC
CTCATCGAAGTCACTGACTTTACCAAGAATCATATTACTTTTAAGGACCGTGATCTGCTCAAGCCACCCAGTGCC
ACGTCGCAAATGTCGGGCTCTTCGCCCTCGCGAGAGTCGGGACCGAGTTTTCGGCATATATATAACCGGCTCCTG
GGCCCTACATATCCCGGCGAGTTTATCCCCCCGGAAAAGGATGGCCAAGACGGCATCTACGTGCTCTCGTATCCC
GGTGTCGCCTTTAACTTCGCCCTGGCCAAGGAGGCATATTCGCCCGAAATAGACGTTGTTTCGCAGTTTGCCGCC
ATGTCGTCACAGTTGGCCAAATCAATGGCCATTTTTAGTGGTGATTCATGGGCTGTGGCACGTCCCACGCTTTGG
ACGGCGGCACTTCCCAGTATTAAAACGACCTCTGTCGTGCCTCGTGCCAAAGACGTGTACTCTGACGAGATATCG
CTTGTGCGCCTGTACGGAGGCGGCAAGATTGACGTGTTGCGCAAATGGACCAATAACGGCTTTCGCATTCAGCTG
GGAGAGACGACGCCGCAGGAACTCGTCATGGAACTGGGCCCTCCAAACGCCATATACTACAAAAACGACCAGAGA
ATGATGGTGCATAAGATGCACTCCAAGACTACTGGTCGGGGACAAGTCGTGGCAACAGATCAGAGCCGGACAGAG
GATCTGACGGATACGGACCAGTCGTCTCTTCACACCGGATCTGAAGGCTCCGACGCCGAAGACAGTGTTGATGAA
GACCTGACGAGCAATCTATCTGGGGAATGCTTCTTCAACTACTTTTATCAGGGCTTCGACATACTCCTTTCAAGT
CCACAACAACCTGCCTGCGCGCCGCCGGGCACCGTGTCAAACACTGCATCCACGGGCAAGGCATACAAATCTTAC
CAATCAGAGCAGCTTGTTGCCAACAAGCTCGTCTTGCACGGAAATATCCCCGGCTCCTATGAGTTCAATAGACAT
CGACGCTGCCGCTGGGAGATTGACACATCAGACAAGGACGGTGAGCAGGCACAAGGGATAAACTCGGAAACGCAT
TTTACAGAAATTGAGCAAGAGATGAAGCGACAGTGGGCAAGTTGCTTTGAGCGGCATCAGTCCAACCGAGTTGTC
AAAGGGATGGCTCTGAACCGCGGATGGGGCGATAGTCCCGAGGACAGTTGCGAACTCGTGGGCGGATGGGAGGAG
ACGAGGCCCAAGAAGACACAGTCTGACGGGGATTTGGAGACGACGACGACGCTATATGGCTTTCCGGGCATGGTT
TTTGAAGTGCTCAAGAATGGCTATGTAAACACATTGACTGTTTATTGA
Transcript >OphauG2|5166
ATGACGCTTTACACGGCGCAACTCCATCCCGGACGGGCAATTGGCTTCTTTGTGCTTGGCGCCTCGTTGCACGAG
ATACTGACACGCATCAAGGCCGAGCCAAATTTGTTTCCCAAGATGGAGCTCCTGTTTTCCCACGACCGTCCGCTA
CACGAAGCCGTGTCTATAGCCCTGCCGCAAAATGGATTCCGGCTGCGCTTTGATGGCCCGGAGCAGCGTTTGCGC
CTCATCGAAGTCACTGACTTTACCAAGAATCATATTACTTTTAAGGACCGTGATCTGCTCAAGCCACCCAGTGCC
ACGTCGCAAATGTCGGGCTCTTCGCCCTCGCGAGAGTCGGGACCGAGTTTTCGGCATATATATAACCGGCTCCTG
GGCCCTACATATCCCGGCGAGTTTATCCCCCCGGAAAAGGATGGCCAAGACGGCATCTACGTGCTCTCGTATCCC
GGTGTCGCCTTTAACTTCGCCCTGGCCAAGGAGGCATATTCGCCCGAAATAGACGTTGTTTCGCAGTTTGCCGCC
ATGTCGTCACAGTTGGCCAAATCAATGGCCATTTTTAGTGGTGATTCATGGGCTGTGGCACGTCCCACGCTTTGG
ACGGCGGCACTTCCCAGTATTAAAACGACCTCTGTCGTGCCTCGTGCCAAAGACGTGTACTCTGACGAGATATCG
CTTGTGCGCCTGTACGGAGGCGGCAAGATTGACGTGTTGCGCAAATGGACCAATAACGGCTTTCGCATTCAGCTG
GGAGAGACGACGCCGCAGGAACTCGTCATGGAACTGGGCCCTCCAAACGCCATATACTACAAAAACGACCAGAGA
ATGATGGTGCATAAGATGCACTCCAAGACTACTGGTCGGGGACAAGTCGTGGCAACAGATCAGAGCCGGACAGAG
GATCTGACGGATACGGACCAGTCGTCTCTTCACACCGGATCTGAAGGCTCCGACGCCGAAGACAGTGTTGATGAA
GACCTGACGAGCAATCTATCTGGGGAATGCTTCTTCAACTACTTTTATCAGGGCTTCGACATACTCCTTTCAAGT
CCACAACAACCTGCCTGCGCGCCGCCGGGCACCGTGTCAAACACTGCATCCACGGGCAAGGCATACAAATCTTAC
CAATCAGAGCAGCTTGTTGCCAACAAGCTCGTCTTGCACGGAAATATCCCCGGCTCCTATGAGTTCAATAGACAT
CGACGCTGCCGCTGGGAGATTGACACATCAGACAAGGACGGTGAGCAGGCACAAGGGATAAACTCGGAAACGCAT
TTTACAGAAATTGAGCAAGAGATGAAGCGACAGTGGGCAAGTTGCTTTGAGCGGCATCAGTCCAACCGAGTTGTC
AAAGGGATGGCTCTGAACCGCGGATGGGGCGATAGTCCCGAGGACAGTTGCGAACTCGTGGGCGGATGGGAGGAG
ACGAGGCCCAAGAAGACACAGTCTGACGGGGATTTGGAGACGACGACGACGCTATATGGCTTTCCGGGCATGGTT
TTTGAAGTGCTCAAGAATGGCTATGTAAACACATTGACTGTTTATTGA
Gene >OphauG2|5166
ATGACGCTTTACACGGCGCAACTCCATCCCGGACGGGCAATTGGCTTCTTTGGTACGTCGCACATGAACTCTGGT
CTGCAGTAGGAAACGCTAACTGTTGGCCACGATAGTGCTTGGCGCCTCGTTGCACGAGATACTGACACGCATCAA
GGCCGAGCCAAATTTGTTTCCCAAGATGGAGCTCCTGTTTTCCCACGACCGTCCGCTACACGAAGCCGTGTCTAT
AGCCCTGCCGCAAAATGGATTCCGGCTGCGCTTTGATGGCCCGGAGCAGCGTTTGCGCCTCATCGAAGTCACTGA
CTTTACCAAGAATCATATTACTTTTAAGGACCGTGATCTGCTCAAGCCACCCAGTGCCACGTCGCAAATGTCGGG
CTCTTCGCCCTCGCGAGAGTCGGGACCGAGTTTTCGGCATATATATAACCGGCTCCTGGGCCCTACATATCCCGG
CGAGTTTATCCCCCCGGAAAAGGATGGCCAAGACGGCATCTACGTGCTCTCGTATCCCGGTGTCGCCTTTAACTT
CGCCCTGGCCAAGGAGGCATATTCGCCCGAAATAGACGTTGTTTCGCAGTTTGCCGCCATGTCGTCACAGTTGGC
CAAATCAATGGCCATTTTTAGTGGTGATTCATGGGCTGTGGCACGTCCCACGCTTTGGACGGCGGCACTTCCCAG
TATTAAAACGACCTCTGTCGTGCCTCGTGCCAAAGACGTGTACTCTGACGAGATATCGCTTGTGCGCCTGTACGG
AGGCGGCAAGATTGACGTGTTGCGCAAATGGACCAATAACGGCTTTCGCATTCAGCTGGGAGAGACGACGCCGCA
GGAACTCGTCATGGAACTGGGCCCTCCAAACGCCATATACTACAAAAACGACCAGAGAATGATGGTGCATAAGAT
GCACTCCAAGACTACTGGTCGGGGACAAGTCGTGGCAACAGATCAGAGCCGGACAGAGGATCTGACGGATACGGA
CCAGTCGTCTCTTCACACCGGATCTGAAGGCTCCGACGCCGAAGACAGTGTTGATGAAGACCTGACGAGCAATCT
ATCTGGGGAATGCTTCTTCAACTACTTTTATCAGGGCTTCGACATACTCCTTTCAAGTCCACAACAACCTGCCTG
CGCGCCGCCGGGCACCGTGTCAAACACTGCATCCACGGGCAAGGCATACAAATCTTACCAATCAGAGCAGCTTGT
TGCCAACAAGCTCGTCTTGCACGGAAATATCCCCGGCTCCTATGAGTTCAATAGACATCGACGCTGCCGCTGGGA
GATTGACACATCAGACAAGGACGGTGAGCAGGCACAAGGGATAAACTCGGAAACGCATTTTACAGAAATTGAGCA
AGAGATGAAGCGACAGTGGGCAAGTTGCTTTGAGCGGCATCAGTCCAACCGAGTTGTCAAAGGGATGGCTCTGAA
CCGCGGATGGGGCGATAGTCCCGAGGACAGTTGCGAACTCGTGGGCGGATGGGAGGAGACGAGGCCCAAGAAGAC
ACAGTCTGACGGGGATTTGGAGACGACGACGACGCTATATGGCTTTCCGGGCATGGTTTTTGAAGTGCTCAAGAA
TGGCTATGTAAACACATTGACTGTTTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail