Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5155
Gene name
LocationContig_460:3..288
Strand+
Gene length (bp)285
Transcript length (bp)285
Coding sequence length (bp)285
Protein length (aa) 95

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04280 Tim44 Tim44-like domain 1.5E-19 3 88

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60084|TIM44_SCHPO Mitochondrial import inner membrane translocase subunit tim44 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim44 PE=3 SV=1 3 89 2.0E-26
sp|Q01852|TIM44_YEAST Mitochondrial import inner membrane translocase subunit TIM44 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM44 PE=1 SV=1 3 90 2.0E-23
sp|O35857|TIM44_MOUSE Mitochondrial import inner membrane translocase subunit TIM44 OS=Mus musculus GN=Timm44 PE=1 SV=2 7 92 1.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11676
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5155 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5155
MRSDGEILDIRNVDILRARMLEPGDVPVFIVTCRTQEVHVYRNAKTGQLAAGMEDKVQLVTYAIGMTRTPEDVNN
AETRGWRLIEMQKSGRDWY*
Coding >OphauG2|5155
ATGCGGTCCGACGGGGAGATTCTCGACATTCGCAACGTGGACATTTTGCGGGCGCGCATGCTGGAACCCGGCGAC
GTGCCCGTCTTTATCGTGACGTGCCGCACGCAGGAGGTGCACGTCTATCGCAACGCCAAGACGGGGCAGCTTGCG
GCGGGCATGGAGGACAAGGTGCAGCTGGTGACGTATGCCATTGGCATGACGCGGACGCCTGAGGATGTGAATAAT
GCCGAGACGCGCGGGTGGCGGCTGATTGAGATGCAGAAGAGCGGGCGTGATTGGTATTAG
Transcript >OphauG2|5155
ATGCGGTCCGACGGGGAGATTCTCGACATTCGCAACGTGGACATTTTGCGGGCGCGCATGCTGGAACCCGGCGAC
GTGCCCGTCTTTATCGTGACGTGCCGCACGCAGGAGGTGCACGTCTATCGCAACGCCAAGACGGGGCAGCTTGCG
GCGGGCATGGAGGACAAGGTGCAGCTGGTGACGTATGCCATTGGCATGACGCGGACGCCTGAGGATGTGAATAAT
GCCGAGACGCGCGGGTGGCGGCTGATTGAGATGCAGAAGAGCGGGCGTGATTGGTATTAG
Gene >OphauG2|5155
ATGCGGTCCGACGGGGAGATTCTCGACATTCGCAACGTGGACATTTTGCGGGCGCGCATGCTGGAACCCGGCGAC
GTGCCCGTCTTTATCGTGACGTGCCGCACGCAGGAGGTGCACGTCTATCGCAACGCCAAGACGGGGCAGCTTGCG
GCGGGCATGGAGGACAAGGTGCAGCTGGTGACGTATGCCATTGGCATGACGCGGACGCCTGAGGATGTGAATAAT
GCCGAGACGCGCGGGTGGCGGCTGATTGAGATGCAGAAGAGCGGGCGTGATTGGTATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail