Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5151
Gene name
LocationContig_46:34919..35667
Strand-
Gene length (bp)748
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01466 Skp1 Skp1 family, dimerisation domain 4.5E-30 121 168
PF03931 Skp1_POZ Skp1 family, tetramerisation domain 8.3E-16 14 73

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NK13|SKP1_NEUCR E3 ubiquitin ligase complex SCF subunit scon-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-3 PE=1 SV=1 1 171 4.0E-86
sp|C5FHU9|SKP1_ARTOC E3 ubiquitin ligase complex SCF subunit sconC OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconC PE=3 SV=1 6 171 1.0E-80
sp|Q8TGW7|SKP1_ARTOT E3 ubiquitin ligase complex SCF subunit sconC OS=Arthroderma otae GN=sconC PE=2 SV=1 6 171 1.0E-80
sp|D4ARL8|SKP1_ARTBC E3 ubiquitin ligase complex SCF subunit sconC OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconC PE=3 SV=1 6 170 1.0E-80
sp|Q5KU00|SKP1_ASPOR E3 ubiquitin ligase complex SCF subunit sconC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconC PE=3 SV=1 14 171 6.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NK13|SKP1_NEUCR E3 ubiquitin ligase complex SCF subunit scon-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-3 PE=1 SV=1 1 171 4.0E-86
sp|C5FHU9|SKP1_ARTOC E3 ubiquitin ligase complex SCF subunit sconC OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconC PE=3 SV=1 6 171 1.0E-80
sp|Q8TGW7|SKP1_ARTOT E3 ubiquitin ligase complex SCF subunit sconC OS=Arthroderma otae GN=sconC PE=2 SV=1 6 171 1.0E-80
sp|D4ARL8|SKP1_ARTBC E3 ubiquitin ligase complex SCF subunit sconC OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconC PE=3 SV=1 6 170 1.0E-80
sp|Q5KU00|SKP1_ASPOR E3 ubiquitin ligase complex SCF subunit sconC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconC PE=3 SV=1 14 171 6.0E-79
sp|B8NSJ0|SKP1_ASPFN E3 ubiquitin ligase complex SCF subunit sconC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconC PE=3 SV=1 14 171 6.0E-79
sp|A1C9U5|SKP1_ASPCL E3 ubiquitin ligase complex SCF subunit sconC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconC PE=3 SV=1 9 170 3.0E-77
sp|A1CZG3|SKP1_NEOFI E3 ubiquitin ligase complex SCF subunit sconC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconC PE=3 SV=1 14 170 3.0E-77
sp|Q4WTT8|SKP1_ASPFU E3 ubiquitin ligase complex SCF subunit sconC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconC PE=3 SV=1 14 170 3.0E-77
sp|B0Y3B5|SKP1_ASPFC E3 ubiquitin ligase complex SCF subunit sconC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconC PE=3 SV=1 14 170 3.0E-77
sp|Q0CA59|SKP1_ASPTN E3 ubiquitin ligase complex SCF subunit sconC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconC PE=3 SV=1 7 170 1.0E-76
sp|B6QGB9|SKP1_TALMQ E3 ubiquitin ligase complex SCF subunit sconC OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconC PE=3 SV=1 9 171 5.0E-76
sp|B8MDP8|SKP1_TALSN E3 ubiquitin ligase complex SCF subunit sconC OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconC PE=3 SV=1 9 171 3.0E-75
sp|Q5BAX8|SKP1_EMENI E3 ubiquitin ligase complex SCF subunit sconC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconC PE=3 SV=2 14 171 2.0E-71
sp|Q9Y709|SKP1_SCHPO Suppressor of kinetochore protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skp1 PE=1 SV=1 11 171 1.0E-69
sp|P52286|SKP1_YEAST Suppressor of kinetochore protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKP1 PE=1 SV=2 14 171 3.0E-55
sp|G5ECU1|SKR1_CAEEL Skp1-related protein OS=Caenorhabditis elegans GN=skr-1 PE=1 SV=1 14 170 5.0E-55
sp|Q71U00|SKP1_XENLA S-phase kinase-associated protein 1 OS=Xenopus laevis GN=skp1 PE=1 SV=3 14 171 9.0E-55
sp|Q5R512|SKP1_PONAB S-phase kinase-associated protein 1 OS=Pongo abelii GN=SKP1 PE=2 SV=1 14 171 9.0E-55
sp|Q4R5B9|SKP1_MACFA S-phase kinase-associated protein 1 OS=Macaca fascicularis GN=SKP1 PE=2 SV=1 14 171 9.0E-55
sp|P63208|SKP1_HUMAN S-phase kinase-associated protein 1 OS=Homo sapiens GN=SKP1 PE=1 SV=2 14 171 9.0E-55
sp|Q5ZKF5|SKP1_CHICK S-phase kinase-associated protein 1 OS=Gallus gallus GN=SKP1 PE=2 SV=1 14 171 9.0E-55
sp|P63209|SKP1_CAVPO S-phase kinase-associated protein 1 OS=Cavia porcellus GN=SKP1 PE=2 SV=2 14 171 9.0E-55
sp|Q3ZCF3|SKP1_BOVIN S-phase kinase-associated protein 1 OS=Bos taurus GN=SKP1 PE=2 SV=1 14 171 9.0E-55
sp|Q6PEC4|SKP1_RAT S-phase kinase-associated protein 1 OS=Rattus norvegicus GN=Skp1 PE=1 SV=3 14 171 1.0E-54
sp|Q9WTX5|SKP1_MOUSE S-phase kinase-associated protein 1 OS=Mus musculus GN=Skp1 PE=1 SV=3 14 171 1.0E-54
sp|P52285|SKP1A_DICDI SCF ubiquitin ligase complex protein SKP1a OS=Dictyostelium discoideum GN=fpaA PE=1 SV=1 14 171 1.0E-53
sp|Q557E4|SKP1B_DICDI SCF ubiquitin ligase complex protein SKP1b OS=Dictyostelium discoideum GN=fpaB-1 PE=1 SV=1 14 171 2.0E-53
sp|O49484|ASK11_ARATH SKP1-like protein 11 OS=Arabidopsis thaliana GN=ASK11 PE=1 SV=1 8 168 3.0E-43
sp|O65674|ASK12_ARATH SKP1-like protein 12 OS=Arabidopsis thaliana GN=ASK12 PE=1 SV=1 8 168 1.0E-41
sp|Q9LNT9|ASK4_ARATH SKP1-like protein 4 OS=Arabidopsis thaliana GN=ASK4 PE=1 SV=1 14 168 9.0E-39
sp|Q39255|SKP1A_ARATH SKP1-like protein 1A OS=Arabidopsis thaliana GN=SKP1A PE=1 SV=1 8 168 4.0E-38
sp|Q9FHW7|SKP1B_ARATH SKP1-like protein 1B OS=Arabidopsis thaliana GN=SKP1B PE=1 SV=1 7 168 8.0E-36
sp|Q9SL93|ASK3_ARATH SKP1-like protein 3 OS=Arabidopsis thaliana GN=ASK3 PE=1 SV=1 14 168 4.0E-35
sp|Q9LSX9|ASK9_ARATH SKP1-like protein 9 OS=Arabidopsis thaliana GN=ASK9 PE=1 SV=1 8 168 6.0E-35
sp|O81058|ASK19_ARATH SKP1-like protein 19 OS=Arabidopsis thaliana GN=ASK19 PE=1 SV=1 8 168 2.0E-32
sp|O81057|ASK14_ARATH SKP1-like protein 14 OS=Arabidopsis thaliana GN=ASK14 PE=1 SV=1 8 168 5.0E-32
sp|Q9LSX8|ASK10_ARATH SKP1-like protein 10 OS=Arabidopsis thaliana GN=ASK10 PE=1 SV=1 8 168 6.0E-32
sp|Q9M1X5|ASK13_ARATH SKP1-like protein 13 OS=Arabidopsis thaliana GN=ASK13 PE=1 SV=1 9 168 1.0E-31
sp|Q9SY65|ASK18_ARATH SKP1-like protein 18 OS=Arabidopsis thaliana GN=ASK18 PE=1 SV=2 8 167 7.0E-31
sp|Q9M1X4|ASK5_ARATH SKP1-like protein 5 OS=Arabidopsis thaliana GN=ASK5 PE=1 SV=1 9 168 1.0E-30
sp|Q1PEL7|ASK15_ARATH SKP1-like protein 15 OS=Arabidopsis thaliana GN=ASK15 PE=2 SV=2 8 168 1.0E-29
sp|O81055|ASK16_ARATH SKP1-like protein 16 OS=Arabidopsis thaliana GN=ASK16 PE=1 SV=1 8 168 7.0E-27
sp|Q9LSY1|ASK8_ARATH SKP1-like protein 8 OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=1 8 168 3.0E-26
sp|Q9SL65|ASK17_ARATH SKP1-like protein 17 OS=Arabidopsis thaliana GN=ASK17 PE=1 SV=1 8 168 4.0E-19
sp|Q8LF97|ASK21_ARATH SKP1-like protein 21 OS=Arabidopsis thaliana GN=ASK21 PE=2 SV=1 13 158 1.0E-17
sp|A8MQG7|ASK20_ARATH SKP1-like protein 20 OS=Arabidopsis thaliana GN=ASK20 PE=2 SV=1 13 158 2.0E-17
sp|Q9LSY0|ASK7_ARATH SKP1-like protein 7 OS=Arabidopsis thaliana GN=ASK7 PE=2 SV=1 8 135 3.0E-11
sp|Q1PEF6|ASK6_ARATH SKP1-like protein 6 OS=Arabidopsis thaliana GN=ASK6 PE=3 SV=1 49 126 7.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:1901575 organic substance catabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:0006508 proteolysis No
GO:0044248 cellular catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4116
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5151 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6190
Ophiocordyceps camponoti-floridani Ophcf2|05041
Ophiocordyceps camponoti-rufipedis Ophun1|1079
Ophiocordyceps kimflemingae Ophio5|2853
Ophiocordyceps subramaniannii Hirsu2|8336

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5151
MAADTSTSSEKAWLASNDGAIIPVDCDVIERSVLIKNLLHDTEIKSSKESPIPIPNVNEAVLRKVLEWCEWHRSD
PPQALDEDSEARKKSTDIDDWDQKFMQVDQEMLFEIILAANYLDIKPLLDVGCKTVANMIKGKSPEEIRKTFNIT
NDFTPEEEEQIRRENEWAEDR*
Coding >OphauG2|5151
ATGGCTGCCGATACTTCTACATCGTCTGAGAAGGCTTGGCTGGCCTCGAATGATGGCGCCATTATTCCAGTTGAC
TGCGATGTCATTGAACGCTCTGTCCTCATAAAAAACCTGCTCCATGATACAGAGATCAAGTCGTCAAAAGAGTCT
CCTATTCCAATTCCCAACGTCAACGAGGCTGTTCTACGCAAGGTCCTGGAATGGTGTGAGTGGCATCGCAGTGAC
CCTCCCCAGGCTCTCGACGAAGACTCCGAGGCCCGCAAGAAGAGCACAGATATAGATGATTGGGACCAGAAGTTT
ATGCAGGTTGACCAAGAGATGCTTTTCGAAATCATTCTCGCTGCCAACTATCTCGATATTAAGCCATTGCTTGAT
GTCGGGTGCAAGACTGTCGCCAACATGATCAAGGGCAAATCTCCAGAGGAAATCCGAAAGACGTTCAACATCACC
AACGACTTTACCCCAGAGGAAGAGGAACAGATTCGCCGTGAGAACGAGTGGGCTGAAGACAGGTAG
Transcript >OphauG2|5151
ATGGCTGCCGATACTTCTACATCGTCTGAGAAGGCTTGGCTGGCCTCGAATGATGGCGCCATTATTCCAGTTGAC
TGCGATGTCATTGAACGCTCTGTCCTCATAAAAAACCTGCTCCATGATACAGAGATCAAGTCGTCAAAAGAGTCT
CCTATTCCAATTCCCAACGTCAACGAGGCTGTTCTACGCAAGGTCCTGGAATGGTGTGAGTGGCATCGCAGTGAC
CCTCCCCAGGCTCTCGACGAAGACTCCGAGGCCCGCAAGAAGAGCACAGATATAGATGATTGGGACCAGAAGTTT
ATGCAGGTTGACCAAGAGATGCTTTTCGAAATCATTCTCGCTGCCAACTATCTCGATATTAAGCCATTGCTTGAT
GTCGGGTGCAAGACTGTCGCCAACATGATCAAGGGCAAATCTCCAGAGGAAATCCGAAAGACGTTCAACATCACC
AACGACTTTACCCCAGAGGAAGAGGAACAGATTCGCCGTGAGAACGAGTGGGCTGAAGACAGGTAG
Gene >OphauG2|5151
ATGGCTGCCGATACTTCTACATCGTCTGAGAAGGCTTGGCTGGCCTCGAATGATGGCGCCATTATTCCAGTTGGT
GAGCTCACCTTGATTGAACTCCAGAGGCAATGGCTGTGCTCTCTTACCGCATCTCGACACACGCCTCGTCAGCCA
TCTCCAACCACAACCTCTTGTATGCTGACTATTATCCAGACTGCGATGTCATTGAACGCTCTGTCCTCATAAAAA
ACCTGCTCCATGATACAGAGATCAAGTCGTCAAAAGAGTCTCCTATTCCAATTCCCAACGTGCGTATTCTTTGTA
TCCTCAATCAAATACTTCGCCCGCTCACGCTCTTGTAGGTCAACGAGGCTGTTCTACGCAAGGTCCTGGAATGGT
GTGAGTGGCATCGCAGTGACCCTCCCCAGGCTCTCGACGAAGACTCCGAGGCCCGCAAGAAGAGCACAGATATAG
ATGATTGGGACCAGAAGTTTATGCAGGTTGACCAAGAGATGCTTTTCGAAATCATTCTCGTATGTTCTCTCCTCT
ATTCTTGACCTTGGTACTCGCGCTGACGACCATGACGTTGGGTTAGGCTGCCAACTATCTCGATATTAAGCCATT
GCTTGATGTCGGGTGCAAGACTGTCGCCAACATGATCAAGGGCAAATCTCCAGAGGAAATCCGAAAGACGTTCAA
CATCACCAACGACTTTACCCCAGAGGAAGAGGAACAGATTCGCCGTGAGAACGAGTGGGCTGAAGACAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail