Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5148
Gene name
LocationContig_46:25022..29162
Strand+
Gene length (bp)4140
Transcript length (bp)4140
Coding sequence length (bp)4140
Protein length (aa) 1380

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16016 VASt VAD1 Analog of StAR-related lipid transfer domain 1.2E-30 911 1055
PF16746 BAR_3 BAR domain of APPL family 6.8E-12 21 191

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13818|YEE2_SCHPO Uncharacterized PH domain-containing protein C19A8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.02 PE=3 SV=1 7 1217 7.0E-78
sp|P38717|SIP3_YEAST Membrane-anchored lipid-binding protein SIP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIP3 PE=1 SV=1 15 401 1.0E-30
sp|P38851|LAM1_YEAST Membrane-anchored lipid-binding protein LAM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM1 PE=1 SV=1 15 414 3.0E-26
sp|Q9UKG1|DP13A_HUMAN DCC-interacting protein 13-alpha OS=Homo sapiens GN=APPL1 PE=1 SV=1 17 436 3.0E-08
sp|Q8K3H0|DP13A_MOUSE DCC-interacting protein 13-alpha OS=Mus musculus GN=Appl1 PE=1 SV=1 17 436 7.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1224
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5148 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6186
Ophiocordyceps camponoti-floridani Ophcf2|05008
Ophiocordyceps camponoti-rufipedis Ophun1|4082
Ophiocordyceps kimflemingae Ophio5|3422
Ophiocordyceps subramaniannii Hirsu2|10395

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5148
MARCGVASWASVMNRGLPVGLNEAALDSPTFRASAIHFSEQMDALERWLNGYMSSTSKLVHDMMGLEETVNTYLS
KTIPWAADGIIENDYTFLALKRVADGQRECWMQTLSSIKKVDNVVIEPIRAFLGGDMRTFKECRRSLEQTQRVYD
TALGRFVGQSKTKEPSALREDAFAVYENRKAYIQAAMEFCVLAPQLRFAMDQLLVKLCGGMWMDMLRSRDASVNA
TRWAWEMDRVRGWAREMEVSEGSLKRQLEAARREISETVIQDSKPSRELDDYSTCTTAFPGSHGPINMQTKGQEA
TISEKQGWLFLRVISGKPVRYSWVRRWYYCRDGVFGWLMAGPQGVVQGDEIGVLLCNARPAGAEERRFCFEVKTK
NQTMMLQAETQRELMQWVEVFEVTKKKAFEASMSQETGPVAGTMDPAFAISPPSAPEFSARAADGQMNAGEEANA
GFERSAALAVAGADVRQSLDVNSGVGRRSFTALGRDLALREEGESGRDHAARIMQKLDLHRKSVSTAAMEPSLGA
PASAGGGIASLISASHNLLPVHPSNLGPATPRQTGALLPSLDSSAGSLAPMTLARPPTMTSLSRMAVVVTGERSS
GANDWKLPTGIIANYWGSKVWAAAQLREPKDDDDDDDDDDDNAVGLVVAEDSRASSRMPVNYPAELQSQHAQFRL
LFPGAPAGEKLVLVFRAAWSRSVDGAAASEAVDSDGRIYVTSDNMYFYGQQMGLVVAFGLHLDLITEVSTSSGKD
CDYIYLHLGRGGNEVQDGLIAVRVFLDNVDLLHTRLNLLVDNLQAEEPMDSHDLILALVNVEREGYDKASPSGES
WEEVSSNTPVDDGTFSGKPASRPRQGQGPRHPGQHSRHRHHGDAQHEHRWQAAGYGSHRHHRGPPKLHLPAQPVV
YEPDDMVEMAAERHFEISAKACFHVLFGDKSFVFPKLYFERRAQQIAQGPWLLVDQGKMRRDFSFSVRNVDMLGR
ARWANINDFQRIDVYSDHVTYVVTHSKTAWHLPHSGSFKLVTKIVISYLAKSKSKLAIYIGIDWSKAPALSKKLV
ERQALHDAANDAEELAELATDQVRKLGPRSRTNRAIQVYGHVGQQTQVVVFSPATSESSKRQTVKPRTLTALLLE
TARSFAESAVSSLIMWAFAGLRKLFAIVSAQRLLLTLLVLSLVTNVLLTSAESSAWWRERRAVRFMQKVGVGPNT
MMSKAVYISDLDEAVRGGEGAFSFARDGGSQDGNNSSACFGTFKTLLDASDMDAPWQEAGAKLTWPRSRATARRL
RRTRQRLGSYRHDLVVAMRVVNSVERQVVQSEWENWLVNEKSLCDGLDVVYGGGKAREAQLFASKRLRPEEHRAI
DEWRQSHCGSCRKDLEAVMRQRMTVRAPE*
Coding >OphauG2|5148
ATGGCTAGATGCGGAGTGGCTTCATGGGCCTCGGTGATGAATCGAGGTCTTCCCGTCGGTCTCAACGAAGCTGCA
CTCGACTCTCCGACGTTCCGAGCATCGGCCATACACTTTTCTGAGCAAATGGATGCGTTGGAAAGATGGCTGAAT
GGATACATGTCATCGACGTCGAAGCTGGTGCACGACATGATGGGACTGGAGGAAACAGTCAACACATATCTCAGC
AAGACGATACCTTGGGCAGCAGATGGAATCATTGAGAATGACTACACGTTTCTGGCGCTCAAGCGGGTGGCGGAC
GGACAACGAGAGTGCTGGATGCAAACACTGAGCAGCATCAAGAAGGTGGACAATGTTGTCATTGAGCCCATCCGA
GCCTTTCTTGGCGGAGACATGCGGACTTTCAAGGAGTGCCGGCGAAGCTTGGAGCAGACACAGCGGGTGTACGAC
ACGGCACTTGGTCGGTTTGTGGGCCAGTCCAAGACCAAGGAGCCGTCTGCACTGCGCGAGGACGCATTTGCCGTA
TACGAAAACCGAAAGGCGTACATCCAGGCAGCCATGGAGTTTTGCGTGCTTGCGCCGCAGTTGCGGTTTGCCATG
GACCAGCTGCTGGTGAAGCTTTGCGGCGGCATGTGGATGGATATGCTACGTTCGCGCGACGCGTCGGTCAATGCA
ACCAGATGGGCATGGGAGATGGATCGAGTACGAGGCTGGGCTAGGGAGATGGAGGTGTCGGAGGGCTCGCTGAAG
CGCCAACTGGAAGCGGCAAGAAGAGAAATCAGCGAGACTGTTATCCAAGACTCGAAGCCATCGCGCGAACTCGAC
GACTACAGCACGTGCACGACGGCGTTTCCGGGGTCACACGGCCCAATCAACATGCAGACCAAGGGCCAAGAGGCC
ACGATATCCGAGAAACAGGGATGGCTCTTCCTGCGAGTGATTTCTGGGAAGCCTGTGAGGTATAGCTGGGTGCGT
CGATGGTACTACTGCCGCGATGGTGTCTTTGGCTGGCTGATGGCCGGGCCCCAAGGCGTGGTTCAGGGCGACGAG
ATTGGAGTGCTGCTTTGCAACGCCAGGCCGGCAGGCGCAGAAGAGAGACGCTTCTGCTTCGAAGTCAAGACCAAG
AACCAAACCATGATGCTGCAAGCCGAGACTCAAAGGGAGCTGATGCAGTGGGTCGAGGTGTTTGAGGTGACCAAG
AAGAAGGCGTTTGAGGCCAGCATGAGCCAGGAAACAGGCCCTGTGGCGGGGACCATGGACCCGGCCTTTGCCATC
TCGCCGCCAAGCGCGCCCGAGTTCTCGGCCCGAGCAGCCGATGGACAGATGAATGCGGGGGAAGAAGCCAACGCT
GGGTTTGAGCGCTCGGCCGCACTGGCCGTGGCTGGTGCCGACGTGAGGCAGAGCTTGGACGTGAATAGTGGTGTC
GGGCGGCGGTCTTTTACTGCGCTGGGAAGAGACTTGGCGCTGCGCGAAGAGGGCGAAAGCGGCCGCGACCACGCG
GCGAGAATCATGCAGAAGCTGGATCTCCATCGCAAGTCGGTGTCGACGGCGGCCATGGAGCCGAGTTTGGGGGCT
CCAGCCTCTGCGGGCGGCGGCATTGCGAGTCTGATTTCGGCCAGCCACAACCTTTTGCCGGTGCATCCCTCAAAT
CTAGGTCCCGCGACGCCACGACAGACGGGGGCGCTGCTACCGTCGCTAGACAGCTCGGCTGGGTCGCTGGCTCCC
ATGACGCTGGCACGACCGCCGACAATGACCAGCCTTAGCCGAATGGCAGTGGTTGTGACGGGAGAGCGTAGCTCT
GGAGCCAATGACTGGAAACTTCCCACGGGCATCATTGCCAACTACTGGGGCAGCAAAGTGTGGGCCGCTGCGCAA
TTGCGAGAGCCCAAGGACGACGACGACGACGACGACGACGACGACGACAATGCCGTTGGACTAGTCGTGGCCGAG
GACTCGCGAGCAAGCAGCCGAATGCCGGTCAACTACCCAGCCGAGCTCCAGAGCCAGCACGCACAGTTTCGCCTC
CTCTTCCCGGGAGCGCCTGCTGGTGAGAAGCTCGTGCTCGTCTTTCGGGCTGCTTGGTCACGGTCAGTGGATGGC
GCAGCGGCCAGCGAGGCGGTGGACAGCGACGGACGAATCTACGTGACCTCGGACAATATGTATTTCTACGGACAG
CAGATGGGCCTGGTGGTGGCTTTCGGGCTCCATCTAGACCTCATTACCGAAGTGTCGACGTCTAGCGGCAAGGAC
TGCGACTACATCTATCTGCACCTGGGGCGTGGGGGCAACGAGGTCCAAGACGGACTGATTGCGGTGCGAGTTTTC
CTGGACAATGTCGACTTGCTGCACACTCGTCTGAACCTGCTGGTGGACAATCTGCAGGCTGAGGAGCCCATGGAC
AGCCACGACCTCATCCTGGCGCTGGTCAATGTCGAGAGAGAGGGCTACGACAAGGCGAGTCCGAGTGGCGAGAGC
TGGGAGGAAGTCTCGTCCAACACGCCCGTTGACGACGGCACCTTTTCGGGCAAGCCGGCATCGCGTCCACGGCAA
GGCCAAGGGCCTAGACACCCAGGCCAGCACAGCCGCCACCGCCACCACGGCGACGCTCAGCATGAGCACAGATGG
CAGGCGGCAGGCTACGGGTCGCACAGGCATCACCGAGGACCGCCCAAGCTGCATCTCCCGGCACAGCCCGTGGTG
TACGAGCCAGACGACATGGTGGAAATGGCAGCCGAGAGGCATTTCGAAATCAGCGCCAAGGCCTGCTTCCACGTG
CTCTTTGGCGACAAGAGCTTCGTCTTCCCCAAGCTCTACTTTGAGCGGCGAGCACAGCAAATCGCCCAGGGCCCC
TGGCTGCTGGTGGACCAGGGCAAAATGCGCCGCGACTTCAGCTTTAGCGTGCGCAATGTGGACATGCTGGGCAGG
GCCAGATGGGCCAACATCAACGACTTCCAGCGCATCGATGTCTACAGCGACCACGTGACGTATGTTGTGACACAC
AGCAAGACGGCCTGGCATCTGCCGCACTCGGGCAGCTTCAAGCTGGTGACCAAGATTGTCATTAGCTACCTGGCC
AAGTCCAAGTCCAAGCTGGCCATTTACATTGGCATCGACTGGTCCAAGGCGCCCGCTCTATCCAAGAAGCTGGTG
GAGCGCCAGGCGCTGCATGACGCGGCCAATGACGCCGAGGAGCTGGCCGAGCTGGCAACAGACCAGGTGCGCAAG
CTGGGGCCGCGCAGCCGCACCAACCGCGCCATTCAGGTCTATGGCCATGTCGGGCAGCAAACTCAGGTTGTCGTC
TTCTCGCCCGCCACGAGCGAGTCGAGCAAAAGACAGACGGTCAAGCCACGCACCCTGACCGCGCTGCTGCTCGAG
ACGGCGCGGTCCTTTGCCGAGAGTGCCGTCTCGTCGCTCATCATGTGGGCCTTTGCCGGCCTGCGCAAGCTGTTT
GCCATTGTCTCGGCCCAGCGCCTGCTTTTGACTCTTCTTGTGCTGAGCCTGGTGACGAATGTGTTGCTGACCTCT
GCAGAGTCATCGGCGTGGTGGAGGGAGAGACGGGCAGTGCGCTTCATGCAAAAAGTGGGCGTTGGGCCCAACACA
ATGATGAGCAAGGCAGTCTACATCAGTGATCTTGACGAGGCTGTCCGGGGCGGCGAAGGCGCTTTTTCGTTTGCA
AGGGACGGCGGCAGCCAAGACGGCAACAACAGCAGTGCCTGCTTTGGCACCTTCAAGACCCTCCTGGATGCCAGC
GACATGGATGCGCCGTGGCAAGAGGCGGGAGCCAAGCTGACGTGGCCCCGGAGCCGGGCGACGGCGCGCCGGTTG
CGCAGAACAAGGCAGCGCCTGGGCTCGTACCGGCACGACCTGGTGGTGGCGATGCGTGTAGTCAACAGCGTCGAG
CGCCAAGTGGTGCAGTCAGAGTGGGAGAACTGGCTCGTCAATGAAAAGTCCTTGTGCGACGGCCTCGATGTTGTC
TATGGCGGAGGAAAGGCAAGAGAGGCACAGCTGTTTGCCAGCAAGCGCCTGAGGCCTGAGGAGCATAGGGCTATT
GACGAGTGGAGGCAGAGTCACTGTGGAAGCTGTCGCAAGGACCTTGAGGCTGTCATGCGCCAAAGGATGACGGTC
AGAGCACCAGAGTAA
Transcript >OphauG2|5148
ATGGCTAGATGCGGAGTGGCTTCATGGGCCTCGGTGATGAATCGAGGTCTTCCCGTCGGTCTCAACGAAGCTGCA
CTCGACTCTCCGACGTTCCGAGCATCGGCCATACACTTTTCTGAGCAAATGGATGCGTTGGAAAGATGGCTGAAT
GGATACATGTCATCGACGTCGAAGCTGGTGCACGACATGATGGGACTGGAGGAAACAGTCAACACATATCTCAGC
AAGACGATACCTTGGGCAGCAGATGGAATCATTGAGAATGACTACACGTTTCTGGCGCTCAAGCGGGTGGCGGAC
GGACAACGAGAGTGCTGGATGCAAACACTGAGCAGCATCAAGAAGGTGGACAATGTTGTCATTGAGCCCATCCGA
GCCTTTCTTGGCGGAGACATGCGGACTTTCAAGGAGTGCCGGCGAAGCTTGGAGCAGACACAGCGGGTGTACGAC
ACGGCACTTGGTCGGTTTGTGGGCCAGTCCAAGACCAAGGAGCCGTCTGCACTGCGCGAGGACGCATTTGCCGTA
TACGAAAACCGAAAGGCGTACATCCAGGCAGCCATGGAGTTTTGCGTGCTTGCGCCGCAGTTGCGGTTTGCCATG
GACCAGCTGCTGGTGAAGCTTTGCGGCGGCATGTGGATGGATATGCTACGTTCGCGCGACGCGTCGGTCAATGCA
ACCAGATGGGCATGGGAGATGGATCGAGTACGAGGCTGGGCTAGGGAGATGGAGGTGTCGGAGGGCTCGCTGAAG
CGCCAACTGGAAGCGGCAAGAAGAGAAATCAGCGAGACTGTTATCCAAGACTCGAAGCCATCGCGCGAACTCGAC
GACTACAGCACGTGCACGACGGCGTTTCCGGGGTCACACGGCCCAATCAACATGCAGACCAAGGGCCAAGAGGCC
ACGATATCCGAGAAACAGGGATGGCTCTTCCTGCGAGTGATTTCTGGGAAGCCTGTGAGGTATAGCTGGGTGCGT
CGATGGTACTACTGCCGCGATGGTGTCTTTGGCTGGCTGATGGCCGGGCCCCAAGGCGTGGTTCAGGGCGACGAG
ATTGGAGTGCTGCTTTGCAACGCCAGGCCGGCAGGCGCAGAAGAGAGACGCTTCTGCTTCGAAGTCAAGACCAAG
AACCAAACCATGATGCTGCAAGCCGAGACTCAAAGGGAGCTGATGCAGTGGGTCGAGGTGTTTGAGGTGACCAAG
AAGAAGGCGTTTGAGGCCAGCATGAGCCAGGAAACAGGCCCTGTGGCGGGGACCATGGACCCGGCCTTTGCCATC
TCGCCGCCAAGCGCGCCCGAGTTCTCGGCCCGAGCAGCCGATGGACAGATGAATGCGGGGGAAGAAGCCAACGCT
GGGTTTGAGCGCTCGGCCGCACTGGCCGTGGCTGGTGCCGACGTGAGGCAGAGCTTGGACGTGAATAGTGGTGTC
GGGCGGCGGTCTTTTACTGCGCTGGGAAGAGACTTGGCGCTGCGCGAAGAGGGCGAAAGCGGCCGCGACCACGCG
GCGAGAATCATGCAGAAGCTGGATCTCCATCGCAAGTCGGTGTCGACGGCGGCCATGGAGCCGAGTTTGGGGGCT
CCAGCCTCTGCGGGCGGCGGCATTGCGAGTCTGATTTCGGCCAGCCACAACCTTTTGCCGGTGCATCCCTCAAAT
CTAGGTCCCGCGACGCCACGACAGACGGGGGCGCTGCTACCGTCGCTAGACAGCTCGGCTGGGTCGCTGGCTCCC
ATGACGCTGGCACGACCGCCGACAATGACCAGCCTTAGCCGAATGGCAGTGGTTGTGACGGGAGAGCGTAGCTCT
GGAGCCAATGACTGGAAACTTCCCACGGGCATCATTGCCAACTACTGGGGCAGCAAAGTGTGGGCCGCTGCGCAA
TTGCGAGAGCCCAAGGACGACGACGACGACGACGACGACGACGACGACAATGCCGTTGGACTAGTCGTGGCCGAG
GACTCGCGAGCAAGCAGCCGAATGCCGGTCAACTACCCAGCCGAGCTCCAGAGCCAGCACGCACAGTTTCGCCTC
CTCTTCCCGGGAGCGCCTGCTGGTGAGAAGCTCGTGCTCGTCTTTCGGGCTGCTTGGTCACGGTCAGTGGATGGC
GCAGCGGCCAGCGAGGCGGTGGACAGCGACGGACGAATCTACGTGACCTCGGACAATATGTATTTCTACGGACAG
CAGATGGGCCTGGTGGTGGCTTTCGGGCTCCATCTAGACCTCATTACCGAAGTGTCGACGTCTAGCGGCAAGGAC
TGCGACTACATCTATCTGCACCTGGGGCGTGGGGGCAACGAGGTCCAAGACGGACTGATTGCGGTGCGAGTTTTC
CTGGACAATGTCGACTTGCTGCACACTCGTCTGAACCTGCTGGTGGACAATCTGCAGGCTGAGGAGCCCATGGAC
AGCCACGACCTCATCCTGGCGCTGGTCAATGTCGAGAGAGAGGGCTACGACAAGGCGAGTCCGAGTGGCGAGAGC
TGGGAGGAAGTCTCGTCCAACACGCCCGTTGACGACGGCACCTTTTCGGGCAAGCCGGCATCGCGTCCACGGCAA
GGCCAAGGGCCTAGACACCCAGGCCAGCACAGCCGCCACCGCCACCACGGCGACGCTCAGCATGAGCACAGATGG
CAGGCGGCAGGCTACGGGTCGCACAGGCATCACCGAGGACCGCCCAAGCTGCATCTCCCGGCACAGCCCGTGGTG
TACGAGCCAGACGACATGGTGGAAATGGCAGCCGAGAGGCATTTCGAAATCAGCGCCAAGGCCTGCTTCCACGTG
CTCTTTGGCGACAAGAGCTTCGTCTTCCCCAAGCTCTACTTTGAGCGGCGAGCACAGCAAATCGCCCAGGGCCCC
TGGCTGCTGGTGGACCAGGGCAAAATGCGCCGCGACTTCAGCTTTAGCGTGCGCAATGTGGACATGCTGGGCAGG
GCCAGATGGGCCAACATCAACGACTTCCAGCGCATCGATGTCTACAGCGACCACGTGACGTATGTTGTGACACAC
AGCAAGACGGCCTGGCATCTGCCGCACTCGGGCAGCTTCAAGCTGGTGACCAAGATTGTCATTAGCTACCTGGCC
AAGTCCAAGTCCAAGCTGGCCATTTACATTGGCATCGACTGGTCCAAGGCGCCCGCTCTATCCAAGAAGCTGGTG
GAGCGCCAGGCGCTGCATGACGCGGCCAATGACGCCGAGGAGCTGGCCGAGCTGGCAACAGACCAGGTGCGCAAG
CTGGGGCCGCGCAGCCGCACCAACCGCGCCATTCAGGTCTATGGCCATGTCGGGCAGCAAACTCAGGTTGTCGTC
TTCTCGCCCGCCACGAGCGAGTCGAGCAAAAGACAGACGGTCAAGCCACGCACCCTGACCGCGCTGCTGCTCGAG
ACGGCGCGGTCCTTTGCCGAGAGTGCCGTCTCGTCGCTCATCATGTGGGCCTTTGCCGGCCTGCGCAAGCTGTTT
GCCATTGTCTCGGCCCAGCGCCTGCTTTTGACTCTTCTTGTGCTGAGCCTGGTGACGAATGTGTTGCTGACCTCT
GCAGAGTCATCGGCGTGGTGGAGGGAGAGACGGGCAGTGCGCTTCATGCAAAAAGTGGGCGTTGGGCCCAACACA
ATGATGAGCAAGGCAGTCTACATCAGTGATCTTGACGAGGCTGTCCGGGGCGGCGAAGGCGCTTTTTCGTTTGCA
AGGGACGGCGGCAGCCAAGACGGCAACAACAGCAGTGCCTGCTTTGGCACCTTCAAGACCCTCCTGGATGCCAGC
GACATGGATGCGCCGTGGCAAGAGGCGGGAGCCAAGCTGACGTGGCCCCGGAGCCGGGCGACGGCGCGCCGGTTG
CGCAGAACAAGGCAGCGCCTGGGCTCGTACCGGCACGACCTGGTGGTGGCGATGCGTGTAGTCAACAGCGTCGAG
CGCCAAGTGGTGCAGTCAGAGTGGGAGAACTGGCTCGTCAATGAAAAGTCCTTGTGCGACGGCCTCGATGTTGTC
TATGGCGGAGGAAAGGCAAGAGAGGCACAGCTGTTTGCCAGCAAGCGCCTGAGGCCTGAGGAGCATAGGGCTATT
GACGAGTGGAGGCAGAGTCACTGTGGAAGCTGTCGCAAGGACCTTGAGGCTGTCATGCGCCAAAGGATGACGGTC
AGAGCACCAGAGTAA
Gene >OphauG2|5148
ATGGCTAGATGCGGAGTGGCTTCATGGGCCTCGGTGATGAATCGAGGTCTTCCCGTCGGTCTCAACGAAGCTGCA
CTCGACTCTCCGACGTTCCGAGCATCGGCCATACACTTTTCTGAGCAAATGGATGCGTTGGAAAGATGGCTGAAT
GGATACATGTCATCGACGTCGAAGCTGGTGCACGACATGATGGGACTGGAGGAAACAGTCAACACATATCTCAGC
AAGACGATACCTTGGGCAGCAGATGGAATCATTGAGAATGACTACACGTTTCTGGCGCTCAAGCGGGTGGCGGAC
GGACAACGAGAGTGCTGGATGCAAACACTGAGCAGCATCAAGAAGGTGGACAATGTTGTCATTGAGCCCATCCGA
GCCTTTCTTGGCGGAGACATGCGGACTTTCAAGGAGTGCCGGCGAAGCTTGGAGCAGACACAGCGGGTGTACGAC
ACGGCACTTGGTCGGTTTGTGGGCCAGTCCAAGACCAAGGAGCCGTCTGCACTGCGCGAGGACGCATTTGCCGTA
TACGAAAACCGAAAGGCGTACATCCAGGCAGCCATGGAGTTTTGCGTGCTTGCGCCGCAGTTGCGGTTTGCCATG
GACCAGCTGCTGGTGAAGCTTTGCGGCGGCATGTGGATGGATATGCTACGTTCGCGCGACGCGTCGGTCAATGCA
ACCAGATGGGCATGGGAGATGGATCGAGTACGAGGCTGGGCTAGGGAGATGGAGGTGTCGGAGGGCTCGCTGAAG
CGCCAACTGGAAGCGGCAAGAAGAGAAATCAGCGAGACTGTTATCCAAGACTCGAAGCCATCGCGCGAACTCGAC
GACTACAGCACGTGCACGACGGCGTTTCCGGGGTCACACGGCCCAATCAACATGCAGACCAAGGGCCAAGAGGCC
ACGATATCCGAGAAACAGGGATGGCTCTTCCTGCGAGTGATTTCTGGGAAGCCTGTGAGGTATAGCTGGGTGCGT
CGATGGTACTACTGCCGCGATGGTGTCTTTGGCTGGCTGATGGCCGGGCCCCAAGGCGTGGTTCAGGGCGACGAG
ATTGGAGTGCTGCTTTGCAACGCCAGGCCGGCAGGCGCAGAAGAGAGACGCTTCTGCTTCGAAGTCAAGACCAAG
AACCAAACCATGATGCTGCAAGCCGAGACTCAAAGGGAGCTGATGCAGTGGGTCGAGGTGTTTGAGGTGACCAAG
AAGAAGGCGTTTGAGGCCAGCATGAGCCAGGAAACAGGCCCTGTGGCGGGGACCATGGACCCGGCCTTTGCCATC
TCGCCGCCAAGCGCGCCCGAGTTCTCGGCCCGAGCAGCCGATGGACAGATGAATGCGGGGGAAGAAGCCAACGCT
GGGTTTGAGCGCTCGGCCGCACTGGCCGTGGCTGGTGCCGACGTGAGGCAGAGCTTGGACGTGAATAGTGGTGTC
GGGCGGCGGTCTTTTACTGCGCTGGGAAGAGACTTGGCGCTGCGCGAAGAGGGCGAAAGCGGCCGCGACCACGCG
GCGAGAATCATGCAGAAGCTGGATCTCCATCGCAAGTCGGTGTCGACGGCGGCCATGGAGCCGAGTTTGGGGGCT
CCAGCCTCTGCGGGCGGCGGCATTGCGAGTCTGATTTCGGCCAGCCACAACCTTTTGCCGGTGCATCCCTCAAAT
CTAGGTCCCGCGACGCCACGACAGACGGGGGCGCTGCTACCGTCGCTAGACAGCTCGGCTGGGTCGCTGGCTCCC
ATGACGCTGGCACGACCGCCGACAATGACCAGCCTTAGCCGAATGGCAGTGGTTGTGACGGGAGAGCGTAGCTCT
GGAGCCAATGACTGGAAACTTCCCACGGGCATCATTGCCAACTACTGGGGCAGCAAAGTGTGGGCCGCTGCGCAA
TTGCGAGAGCCCAAGGACGACGACGACGACGACGACGACGACGACGACAATGCCGTTGGACTAGTCGTGGCCGAG
GACTCGCGAGCAAGCAGCCGAATGCCGGTCAACTACCCAGCCGAGCTCCAGAGCCAGCACGCACAGTTTCGCCTC
CTCTTCCCGGGAGCGCCTGCTGGTGAGAAGCTCGTGCTCGTCTTTCGGGCTGCTTGGTCACGGTCAGTGGATGGC
GCAGCGGCCAGCGAGGCGGTGGACAGCGACGGACGAATCTACGTGACCTCGGACAATATGTATTTCTACGGACAG
CAGATGGGCCTGGTGGTGGCTTTCGGGCTCCATCTAGACCTCATTACCGAAGTGTCGACGTCTAGCGGCAAGGAC
TGCGACTACATCTATCTGCACCTGGGGCGTGGGGGCAACGAGGTCCAAGACGGACTGATTGCGGTGCGAGTTTTC
CTGGACAATGTCGACTTGCTGCACACTCGTCTGAACCTGCTGGTGGACAATCTGCAGGCTGAGGAGCCCATGGAC
AGCCACGACCTCATCCTGGCGCTGGTCAATGTCGAGAGAGAGGGCTACGACAAGGCGAGTCCGAGTGGCGAGAGC
TGGGAGGAAGTCTCGTCCAACACGCCCGTTGACGACGGCACCTTTTCGGGCAAGCCGGCATCGCGTCCACGGCAA
GGCCAAGGGCCTAGACACCCAGGCCAGCACAGCCGCCACCGCCACCACGGCGACGCTCAGCATGAGCACAGATGG
CAGGCGGCAGGCTACGGGTCGCACAGGCATCACCGAGGACCGCCCAAGCTGCATCTCCCGGCACAGCCCGTGGTG
TACGAGCCAGACGACATGGTGGAAATGGCAGCCGAGAGGCATTTCGAAATCAGCGCCAAGGCCTGCTTCCACGTG
CTCTTTGGCGACAAGAGCTTCGTCTTCCCCAAGCTCTACTTTGAGCGGCGAGCACAGCAAATCGCCCAGGGCCCC
TGGCTGCTGGTGGACCAGGGCAAAATGCGCCGCGACTTCAGCTTTAGCGTGCGCAATGTGGACATGCTGGGCAGG
GCCAGATGGGCCAACATCAACGACTTCCAGCGCATCGATGTCTACAGCGACCACGTGACGTATGTTGTGACACAC
AGCAAGACGGCCTGGCATCTGCCGCACTCGGGCAGCTTCAAGCTGGTGACCAAGATTGTCATTAGCTACCTGGCC
AAGTCCAAGTCCAAGCTGGCCATTTACATTGGCATCGACTGGTCCAAGGCGCCCGCTCTATCCAAGAAGCTGGTG
GAGCGCCAGGCGCTGCATGACGCGGCCAATGACGCCGAGGAGCTGGCCGAGCTGGCAACAGACCAGGTGCGCAAG
CTGGGGCCGCGCAGCCGCACCAACCGCGCCATTCAGGTCTATGGCCATGTCGGGCAGCAAACTCAGGTTGTCGTC
TTCTCGCCCGCCACGAGCGAGTCGAGCAAAAGACAGACGGTCAAGCCACGCACCCTGACCGCGCTGCTGCTCGAG
ACGGCGCGGTCCTTTGCCGAGAGTGCCGTCTCGTCGCTCATCATGTGGGCCTTTGCCGGCCTGCGCAAGCTGTTT
GCCATTGTCTCGGCCCAGCGCCTGCTTTTGACTCTTCTTGTGCTGAGCCTGGTGACGAATGTGTTGCTGACCTCT
GCAGAGTCATCGGCGTGGTGGAGGGAGAGACGGGCAGTGCGCTTCATGCAAAAAGTGGGCGTTGGGCCCAACACA
ATGATGAGCAAGGCAGTCTACATCAGTGATCTTGACGAGGCTGTCCGGGGCGGCGAAGGCGCTTTTTCGTTTGCA
AGGGACGGCGGCAGCCAAGACGGCAACAACAGCAGTGCCTGCTTTGGCACCTTCAAGACCCTCCTGGATGCCAGC
GACATGGATGCGCCGTGGCAAGAGGCGGGAGCCAAGCTGACGTGGCCCCGGAGCCGGGCGACGGCGCGCCGGTTG
CGCAGAACAAGGCAGCGCCTGGGCTCGTACCGGCACGACCTGGTGGTGGCGATGCGTGTAGTCAACAGCGTCGAG
CGCCAAGTGGTGCAGTCAGAGTGGGAGAACTGGCTCGTCAATGAAAAGTCCTTGTGCGACGGCCTCGATGTTGTC
TATGGCGGAGGAAAGGCAAGAGAGGCACAGCTGTTTGCCAGCAAGCGCCTGAGGCCTGAGGAGCATAGGGCTATT
GACGAGTGGAGGCAGAGTCACTGTGGAAGCTGTCGCAAGGACCTTGAGGCTGTCATGCGCCAAAGGATGACGGTC
AGAGCACCAGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail