Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5130
Gene name
LocationContig_458:12021..15066
Strand-
Gene length (bp)3045
Transcript length (bp)2877
Coding sequence length (bp)2877
Protein length (aa) 959

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14420 Clr5 Clr5 domain 3.3E-23 498 550

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 372 504 1.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 372 583 7.0E-11
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 379 478 1.0E-09
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 378 480 2.0E-08
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 367 495 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 372 504 1.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 372 583 7.0E-11
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 379 478 1.0E-09
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 378 480 2.0E-08
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 367 495 3.0E-08
sp|P33332|SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC3 PE=1 SV=1 375 475 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3697
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5130 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1419
Ophiocordyceps camponoti-floridani Ophcf2|02232
Ophiocordyceps camponoti-rufipedis Ophun1|559
Ophiocordyceps kimflemingae Ophio5|5872
Ophiocordyceps subramaniannii Hirsu2|7197

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5130
MFNQSTNASSGFDCDSYGLSHQPWSRFDIDQQHGVDSYHQHHDDQEADAMDWTRSDDAQCGYQDSSQGLEMDTLT
SMQTGGSVGRLVAHFENKAFSPFEAAPRLPPRPPAAAGLESRDQSGGFDGLVYYGNAAASFSPNRMATPMTSPGD
SSWGSFGVQSRTTSPSTMAYAGFHHDAHARMTSPMATQFASFGDFMSPGCGNNNSSSSSNDNSCSNTCSNNCSNH
GSNNCSNHGSNSGSNCSNTCSIHPSPSHSHSASSQLPPAAGTPGFEIWRAPPSANIKPEPAPAPRPNGFYKPPVP
TTPKPAINADSQFILDFTPAKPNKGKAPAKPPRLRAPPPIPPPFRPVVKQEPATPQAPEAPPPPLSATVSSRQAQ
HFQLQQLEQHHLEEQRRLQQQHQEQQRQLEQQHRQQQRQHLEQQQRHQQEQHQLELQQRQRQLQLQQQLQQQQQQ
LEQQRQRQQQEQEQQQQQQAQHQHAARQPSVSLRTANVARPSREQVPAEAWEQYKSTIRALYLDERRPLKEVMAI
MAEKYNFQATPKMYKTRFSQWGFVKNNTEEEVKRLLSMKFQRDAEGKVSEFVRNGRVVNLGTYLKRKGVTEYDLI
DFELPADLPAHVRCRTPTPPPAPGYLQSPDLLRAQELVVGNMRKAFMQCRQLEVDADVQVAWSITMVWGAGSSDL
LMEANFYFEARDADQGGHFLMKAFKQLEVDLKKLSPLGIKELLLGMVQRDPGMITALCKYLAAYSATNLERAHPL
RQIFTCLYEIQQKHGASTLSDLLWGSMPTIAEELEAIYSRRHPYVARTWIDLALFYNQARPERLDKLVGELRAQQ
RQLELRHGANSVQVLPLKYCVLQLLWVTSPRSSATKQAAVDMWNHMRNLGVVFAVRDSKPNVYCYHSPIKVDPWT
KRCRRRYDSGVAIIQEHVGVKILPYFEEDFHTTVHAPDAQEAWSTALEHVQSSKWAFI*
Coding >OphauG2|5130
ATGTTCAATCAGTCCACCAATGCGTCGTCTGGCTTTGACTGCGATTCATATGGCCTCTCGCACCAGCCGTGGTCA
CGGTTCGACATTGACCAGCAGCATGGCGTCGACTCGTACCACCAGCACCATGACGACCAAGAAGCCGATGCCATG
GACTGGACTCGGTCGGACGACGCCCAATGCGGCTACCAAGACTCGTCCCAGGGCCTCGAGATGGACACGCTGACG
TCGATGCAGACGGGAGGCAGCGTTGGACGGTTGGTGGCGCACTTTGAGAACAAGGCCTTTTCTCCCTTTGAAGCA
GCGCCGCGTCTGCCGCCCCGGCCACCCGCCGCGGCCGGGCTGGAATCGAGAGACCAGTCGGGCGGCTTTGATGGG
CTCGTCTACTACGGCAACGCAGCGGCGTCGTTTAGCCCCAATCGCATGGCCACGCCCATGACCAGCCCGGGCGAC
TCGTCGTGGGGATCGTTTGGCGTCCAGTCGCGCACAACCAGCCCGTCCACCATGGCCTACGCCGGCTTCCACCAT
GACGCCCACGCGCGCATGACGAGCCCCATGGCGACTCAGTTTGCCAGTTTTGGAGACTTTATGTCGCCGGGCTGT
GGCAACAACAACAGCAGCAGCAGCAGCAACGACAACAGCTGCTCCAATACTTGCTCCAACAACTGCTCCAACCAC
GGCTCCAACAACTGCTCCAACCACGGCTCCAACAGCGGCTCCAACTGCTCCAACACCTGCTCCATCCATCCCTCC
CCCTCCCACTCGCACTCGGCCTCCTCGCAGCTCCCCCCCGCCGCCGGAACCCCAGGCTTCGAGATTTGGCGAGCT
CCTCCGTCAGCAAACATCAAGCCCGAGCCGGCTCCCGCCCCCCGCCCAAACGGCTTTTACAAACCCCCCGTGCCA
ACCACGCCCAAACCAGCCATCAATGCCGACTCGCAATTCATCCTCGACTTCACCCCCGCCAAGCCCAACAAGGGA
AAGGCCCCCGCAAAGCCCCCCAGGCTTCGTGCTCCGCCGCCGATCCCGCCACCTTTTCGGCCCGTGGTGAAACAG
GAACCGGCCACGCCCCAGGCACCAGAAGCGCCACCTCCACCCCTATCTGCCACTGTCTCGAGTCGTCAGGCCCAG
CATTTTCAGCTGCAGCAGCTTGAGCAGCATCATCTTGAAGAGCAGCGTCGTCTGCAGCAGCAACACCAGGAGCAG
CAAAGACAGCTCGAGCAGCAGCATCGCCAGCAGCAGAGACAGCACCTGGAGCAGCAGCAGCGGCATCAGCAGGAA
CAGCATCAACTCGAGTTGCAGCAGCGGCAGCGGCAGCTCCAGCTCCAACAACAGCTGCAACAGCAGCAGCAGCAA
CTCGAGCAACAACGACAGCGACAGCAACAAGAACAAGAGCAGCAGCAGCAGCAGCAGGCTCAGCACCAGCACGCT
GCAAGACAGCCGTCGGTCTCTCTACGAACCGCAAACGTTGCCCGTCCCTCGCGAGAACAGGTCCCAGCAGAGGCC
TGGGAGCAGTACAAGTCCACCATTCGCGCCCTGTACCTGGACGAGAGACGGCCGCTCAAGGAGGTCATGGCAATC
ATGGCTGAAAAGTACAACTTTCAAGCAACCCCCAAAATGTACAAGACGCGCTTCTCACAATGGGGCTTTGTCAAA
AACAACACCGAGGAGGAAGTCAAACGGCTCCTCTCCATGAAGTTCCAGCGCGACGCCGAGGGCAAGGTTTCGGAA
TTCGTGCGCAACGGACGCGTCGTCAACCTCGGCACCTACCTCAAGCGAAAAGGCGTGACGGAATACGACCTCATC
GACTTTGAGCTGCCGGCCGACCTGCCGGCGCATGTGCGGTGTCGGACGCCAACGCCGCCGCCTGCGCCTGGCTAT
CTGCAGTCGCCCGACCTGCTGCGGGCACAGGAGCTGGTGGTGGGCAACATGCGCAAGGCGTTTATGCAGTGCCGC
CAGCTCGAGGTGGACGCGGACGTGCAGGTGGCATGGTCCATCACCATGGTCTGGGGCGCGGGATCGAGCGACCTG
CTGATGGAGGCGAATTTCTACTTTGAGGCGCGAGACGCGGACCAGGGCGGGCACTTCCTCATGAAGGCGTTTAAG
CAGCTCGAGGTCGACTTGAAGAAGCTGTCGCCGCTGGGCATCAAGGAGCTGCTGCTGGGCATGGTGCAGCGCGAC
CCGGGCATGATTACGGCGCTGTGCAAATACCTGGCTGCCTACTCGGCCACCAACCTCGAGCGCGCGCATCCGCTG
CGCCAAATCTTCACCTGCCTCTACGAGATCCAGCAGAAGCACGGCGCGTCGACGCTGTCGGACCTGCTGTGGGGC
AGCATGCCCACCATTGCCGAGGAGCTCGAGGCCATCTACTCGCGCCGCCATCCATACGTGGCCCGCACATGGATC
GACCTGGCCCTGTTCTACAACCAGGCCCGCCCCGAGCGCCTCGACAAGCTGGTGGGCGAGCTGCGCGCCCAGCAG
CGCCAGCTCGAGCTGCGCCATGGCGCCAACAGCGTCCAGGTGCTGCCGCTCAAGTACTGCGTGCTGCAGCTGCTC
TGGGTCACCAGCCCGCGCTCCAGCGCCACCAAGCAGGCCGCCGTCGACATGTGGAACCACATGCGCAACCTGGGC
GTCGTCTTTGCCGTCCGCGACTCCAAGCCAAACGTCTACTGCTACCATAGCCCCATCAAGGTCGACCCCTGGACC
AAGCGCTGCCGCCGCCGCTACGACTCGGGCGTCGCCATTATACAGGAGCACGTGGGCGTCAAGATCTTGCCCTAC
TTTGAAGAGGACTTTCACACCACGGTCCATGCCCCAGATGCCCAGGAGGCTTGGTCCACGGCGCTGGAGCACGTC
CAGTCGTCCAAGTGGGCCTTTATATAA
Transcript >OphauG2|5130
ATGTTCAATCAGTCCACCAATGCGTCGTCTGGCTTTGACTGCGATTCATATGGCCTCTCGCACCAGCCGTGGTCA
CGGTTCGACATTGACCAGCAGCATGGCGTCGACTCGTACCACCAGCACCATGACGACCAAGAAGCCGATGCCATG
GACTGGACTCGGTCGGACGACGCCCAATGCGGCTACCAAGACTCGTCCCAGGGCCTCGAGATGGACACGCTGACG
TCGATGCAGACGGGAGGCAGCGTTGGACGGTTGGTGGCGCACTTTGAGAACAAGGCCTTTTCTCCCTTTGAAGCA
GCGCCGCGTCTGCCGCCCCGGCCACCCGCCGCGGCCGGGCTGGAATCGAGAGACCAGTCGGGCGGCTTTGATGGG
CTCGTCTACTACGGCAACGCAGCGGCGTCGTTTAGCCCCAATCGCATGGCCACGCCCATGACCAGCCCGGGCGAC
TCGTCGTGGGGATCGTTTGGCGTCCAGTCGCGCACAACCAGCCCGTCCACCATGGCCTACGCCGGCTTCCACCAT
GACGCCCACGCGCGCATGACGAGCCCCATGGCGACTCAGTTTGCCAGTTTTGGAGACTTTATGTCGCCGGGCTGT
GGCAACAACAACAGCAGCAGCAGCAGCAACGACAACAGCTGCTCCAATACTTGCTCCAACAACTGCTCCAACCAC
GGCTCCAACAACTGCTCCAACCACGGCTCCAACAGCGGCTCCAACTGCTCCAACACCTGCTCCATCCATCCCTCC
CCCTCCCACTCGCACTCGGCCTCCTCGCAGCTCCCCCCCGCCGCCGGAACCCCAGGCTTCGAGATTTGGCGAGCT
CCTCCGTCAGCAAACATCAAGCCCGAGCCGGCTCCCGCCCCCCGCCCAAACGGCTTTTACAAACCCCCCGTGCCA
ACCACGCCCAAACCAGCCATCAATGCCGACTCGCAATTCATCCTCGACTTCACCCCCGCCAAGCCCAACAAGGGA
AAGGCCCCCGCAAAGCCCCCCAGGCTTCGTGCTCCGCCGCCGATCCCGCCACCTTTTCGGCCCGTGGTGAAACAG
GAACCGGCCACGCCCCAGGCACCAGAAGCGCCACCTCCACCCCTATCTGCCACTGTCTCGAGTCGTCAGGCCCAG
CATTTTCAGCTGCAGCAGCTTGAGCAGCATCATCTTGAAGAGCAGCGTCGTCTGCAGCAGCAACACCAGGAGCAG
CAAAGACAGCTCGAGCAGCAGCATCGCCAGCAGCAGAGACAGCACCTGGAGCAGCAGCAGCGGCATCAGCAGGAA
CAGCATCAACTCGAGTTGCAGCAGCGGCAGCGGCAGCTCCAGCTCCAACAACAGCTGCAACAGCAGCAGCAGCAA
CTCGAGCAACAACGACAGCGACAGCAACAAGAACAAGAGCAGCAGCAGCAGCAGCAGGCTCAGCACCAGCACGCT
GCAAGACAGCCGTCGGTCTCTCTACGAACCGCAAACGTTGCCCGTCCCTCGCGAGAACAGGTCCCAGCAGAGGCC
TGGGAGCAGTACAAGTCCACCATTCGCGCCCTGTACCTGGACGAGAGACGGCCGCTCAAGGAGGTCATGGCAATC
ATGGCTGAAAAGTACAACTTTCAAGCAACCCCCAAAATGTACAAGACGCGCTTCTCACAATGGGGCTTTGTCAAA
AACAACACCGAGGAGGAAGTCAAACGGCTCCTCTCCATGAAGTTCCAGCGCGACGCCGAGGGCAAGGTTTCGGAA
TTCGTGCGCAACGGACGCGTCGTCAACCTCGGCACCTACCTCAAGCGAAAAGGCGTGACGGAATACGACCTCATC
GACTTTGAGCTGCCGGCCGACCTGCCGGCGCATGTGCGGTGTCGGACGCCAACGCCGCCGCCTGCGCCTGGCTAT
CTGCAGTCGCCCGACCTGCTGCGGGCACAGGAGCTGGTGGTGGGCAACATGCGCAAGGCGTTTATGCAGTGCCGC
CAGCTCGAGGTGGACGCGGACGTGCAGGTGGCATGGTCCATCACCATGGTCTGGGGCGCGGGATCGAGCGACCTG
CTGATGGAGGCGAATTTCTACTTTGAGGCGCGAGACGCGGACCAGGGCGGGCACTTCCTCATGAAGGCGTTTAAG
CAGCTCGAGGTCGACTTGAAGAAGCTGTCGCCGCTGGGCATCAAGGAGCTGCTGCTGGGCATGGTGCAGCGCGAC
CCGGGCATGATTACGGCGCTGTGCAAATACCTGGCTGCCTACTCGGCCACCAACCTCGAGCGCGCGCATCCGCTG
CGCCAAATCTTCACCTGCCTCTACGAGATCCAGCAGAAGCACGGCGCGTCGACGCTGTCGGACCTGCTGTGGGGC
AGCATGCCCACCATTGCCGAGGAGCTCGAGGCCATCTACTCGCGCCGCCATCCATACGTGGCCCGCACATGGATC
GACCTGGCCCTGTTCTACAACCAGGCCCGCCCCGAGCGCCTCGACAAGCTGGTGGGCGAGCTGCGCGCCCAGCAG
CGCCAGCTCGAGCTGCGCCATGGCGCCAACAGCGTCCAGGTGCTGCCGCTCAAGTACTGCGTGCTGCAGCTGCTC
TGGGTCACCAGCCCGCGCTCCAGCGCCACCAAGCAGGCCGCCGTCGACATGTGGAACCACATGCGCAACCTGGGC
GTCGTCTTTGCCGTCCGCGACTCCAAGCCAAACGTCTACTGCTACCATAGCCCCATCAAGGTCGACCCCTGGACC
AAGCGCTGCCGCCGCCGCTACGACTCGGGCGTCGCCATTATACAGGAGCACGTGGGCGTCAAGATCTTGCCCTAC
TTTGAAGAGGACTTTCACACCACGGTCCATGCCCCAGATGCCCAGGAGGCTTGGTCCACGGCGCTGGAGCACGTC
CAGTCGTCCAAGTGGGCCTTTATATAA
Gene >OphauG2|5130
ATGTTCAATCAGTCCACCAATGCGTCGTCTGGCTTTGACTGCGATTCATATGGCCTCTCGCACCAGCCGTGGTCA
CGGTTCGACATTGACCAGCAGCATGGCGTCGACTCGTACCACCAGCACCATGACGACCAAGAAGCCGATGCCATG
GACTGGACTCGGTCGGACGACGCCCAATGCGGCTACCAAGACTCGTCCCAGGGCCTCGAGATGGACACGCTGACG
TCGATGCAGACGGGAGGCAGCGTTGGACGGTTGGTGGCGCACTTTGAGAACAAGGCCTTTTCTCCCTTTGAAGCA
GCGCCGCGTCTGCCGCCCCGGCCACCCGCCGCGGCCGGGCTGGAATCGAGAGACCAGTCGGGCGGCTTTGATGGG
CTCGTCTACTACGGCAACGCAGCGGCGTCGTTTAGCCCCAATCGCATGGCCACGCCCATGACCAGCCCGGGCGAC
TCGTCGTGGGGATCGTTTGGCGTCCAGTCGCGCACAACCAGCCCGTCCACCATGGCCTACGCCGGCTTCCACCAT
GACGCCCACGCGCGCATGACGAGCCCCATGGCGACTCAGTTTGCCAGTTTTGGAGACTTTATGTCGCCGGGCTGT
GGCAACAACAACAGCAGCAGCAGCAGCAACGACAACAGCTGCTCCAATACTTGCTCCAACAACTGCTCCAACCAC
GGCTCCAACAACTGCTCCAACCACGGCTCCAACAGCGGCTCCAACTGCTCCAACACCTGCTCCATCCATCCCTCC
CCCTCCCACTCGCACTCGGCCTCCTCGCAGCTCCCCCCCGCCGCCGGAACCCCAGGCTTCGAGATTTGGCGAGCT
CCTCCGTCAGCAAACATCAAGCCCGAGCCGGCTCCCGCCCCCCGCCCAAACGGCTTTTACAAACCCCCCGTGCCA
ACCACGCCCAAACCAGCCATCAATGCCGACTCGCAATTCATCCTCGACTTCACCCCCGCCAAGCCCAACAAGGGA
AAGGCCCCCGCAAAGCCCCCCAGGCTTCGTGCTCCGCCGCCGATCCCGCCACCTTTTCGGCCCGTGGTGAAACAG
GAACCGGCCACGCCCCAGGCACCAGAAGCGCCACCTCCACCCCTATCTGCCACTGTCTCGGTAAGTACCGTTAAT
ACACTTTGTCCCCTCCCCCCCCTGGTTCGCTCACAGTCCTGACCTTGTTGGGGGGGGGGGGGGATTTTTCTCCTC
CGGTTTAGAGTCGTCAGGCCCAGCATTTTCAGCTGCAGCAGCTTGAGCAGCATCATCTTGAAGAGCAGCGTCGTC
TGCAGCAGCAACACCAGGAGCAGCAAAGACAGCTCGAGCAGCAGCATCGCCAGCAGCAGAGACAGCACCTGGAGC
AGCAGCAGCGGCATCAGCAGGAACAGCATCAACTCGAGTTGCAGCAGCGGCAGCGGCAGCTCCAGCTCCAACAAC
AGCTGCAACAGCAGCAGCAGCAACTCGAGCAACAACGACAGCGACAGCAACAAGAACAAGAGCAGCAGCAGCAGC
AGCAGGCTCAGCACCAGCACGCTGCAAGACAGCCGTCGGTCTCTCTACGAACCGCAAACGTTGCCCGTCCCTCGC
GAGAACAGGTCCCAGCAGAGGCCTGGGAGCAGTACAAGTCCACCATTCGCGCCCTGTACCTGGACGAGAGACGGC
CGCTCAAGGAGGTCATGGCAATCATGGCTGAAAAGTACAACTTTCAAGCAACGTAAGCTCGCCACCTTGTCCCCC
CCCTTTGTGCTAACAGTTGGCCAAGAAGACTAATACAAAAAAAAAAGCCCCAAAATGTACAAGACGCGCTTCTCA
CAATGGGGCTTTGTCAAAAACAACACCGAGGAGGAAGTCAAACGGCTCCTCTCCATGAAGTTCCAGCGCGACGCC
GAGGGCAAGGTTTCGGAATTCGTGCGCAACGGACGCGTCGTCAACCTCGGCACCTACCTCAAGCGAAAAGGCGTG
ACGGAATACGACCTCATCGACTTTGAGCTGCCGGCCGACCTGCCGGCGCATGTGCGGTGTCGGACGCCAACGCCG
CCGCCTGCGCCTGGCTATCTGCAGTCGCCCGACCTGCTGCGGGCACAGGAGCTGGTGGTGGGCAACATGCGCAAG
GCGTTTATGCAGTGCCGCCAGCTCGAGGTGGACGCGGACGTGCAGGTGGCATGGTCCATCACCATGGTCTGGGGC
GCGGGATCGAGCGACCTGCTGATGGAGGCGAATTTCTACTTTGAGGCGCGAGACGCGGACCAGGGCGGGCACTTC
CTCATGAAGGCGTTTAAGCAGCTCGAGGTCGACTTGAAGAAGCTGTCGCCGCTGGGCATCAAGGAGCTGCTGCTG
GGCATGGTGCAGCGCGACCCGGGCATGATTACGGCGCTGTGCAAATACCTGGCTGCCTACTCGGCCACCAACCTC
GAGCGCGCGCATCCGCTGCGCCAAATCTTCACCTGCCTCTACGAGATCCAGCAGAAGCACGGCGCGTCGACGCTG
TCGGACCTGCTGTGGGGCAGCATGCCCACCATTGCCGAGGAGCTCGAGGCCATCTACTCGCGCCGCCATCCATAC
GTGGCCCGCACATGGATCGACCTGGCCCTGTTCTACAACCAGGCCCGCCCCGAGCGCCTCGACAAGCTGGTGGGC
GAGCTGCGCGCCCAGCAGCGCCAGCTCGAGCTGCGCCATGGCGCCAACAGCGTCCAGGTGCTGCCGCTCAAGTAC
TGCGTGCTGCAGCTGCTCTGGGTCACCAGCCCGCGCTCCAGCGCCACCAAGCAGGCCGCCGTCGACATGTGGAAC
CACATGCGCAACCTGGGCGTCGTCTTTGCCGTCCGCGACTCCAAGCCAAACGTCTACTGCTACCATAGCCCCATC
AAGGTCGACCCCTGGACCAAGCGCTGCCGCCGCCGCTACGACTCGGGCGTCGCCATTATACAGGAGCACGTGGGC
GTCAAGATCTTGCCCTACTTTGAAGAGGACTTTCACACCACGGTCCATGCCCCAGATGCCCAGGAGGCTTGGTCC
ACGGCGCTGGAGCACGTCCAGTCGTCCAAGTGGGCCTTTATATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail