Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|513
Gene name
LocationContig_112:7003..8479
Strand+
Gene length (bp)1476
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06863 DUF1254 Protein of unknown function (DUF1254) 1.1E-30 62 194
PF06742 DUF1214 Protein of unknown function (DUF1214) 4.0E-13 335 435

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 24 0.997464

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup320
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|513 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5354
Ophiocordyceps camponoti-floridani Ophcf2|00923
Ophiocordyceps camponoti-rufipedis Ophun1|512
Ophiocordyceps kimflemingae Ophio5|4563
Ophiocordyceps kimflemingae Ophio5|7261
Ophiocordyceps subramaniannii Hirsu2|252
Ophiocordyceps subramaniannii Hirsu2|4440
Ophiocordyceps subramaniannii Hirsu2|6269
Ophiocordyceps subramaniannii Hirsu2|6270

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|513
MLSLCTALQALLLPGMACFSFAKADATVDEATEFSLIYGYPLLAYSDSAVPLFEDGLGPQEFLKKRKLAGPEDKS
VVRPNSDTLYSMSLLDLSCDDVVVEVPNVTDRYWVESFYDMYGNNYANLGPISKTPPGKYCVRYAVEANEEPGVQ
LCEDCSDFQGFINSPTIYGTVTDRFLVRDNGTDLAKVHDLQDHSFLIYPIVRNTPHRLQAPPLSQDVLDSCLSND
TPTKIMQLLARLAPYNPSRNISDLNRVNTMLNRAGICDGDYTLPPGVDLAKVAEQANKSVVAQAVKPENIVNVGN
GWSSLAPSAQGDYYIDYKMRAYVAKIGYLALVPTEALYPSRRDSSGSTSLNIGPREAYIITFVDGSPPLAPLGFW
SMTAYNGDQFLVPNDLNRYSLGDRSSLTYPDGSSVSEGGTQKRAFQILVQPADVAPPSNWTSKSVFVSFEMNSS*
Coding >OphauG2|513
ATGTTGTCTCTCTGCACCGCGCTGCAGGCGCTTTTGCTGCCGGGTATGGCTTGCTTCTCTTTTGCTAAAGCTGAT
GCTACAGTGGACGAGGCGACTGAATTTTCATTAATTTACGGCTATCCTCTTCTCGCTTATTCCGACTCGGCTGTT
CCCCTTTTCGAAGACGGATTAGGACCCCAAGAGTTCCTCAAGAAGCGAAAACTCGCAGGCCCAGAGGACAAGTCC
GTTGTACGACCGAATTCCGATACGCTGTATTCCATGTCTCTCCTAGACCTGTCGTGCGATGATGTTGTTGTCGAG
GTTCCCAACGTTACGGATCGATACTGGGTTGAGTCATTCTATGACATGTATGGAAACAACTATGCCAATCTAGGA
CCAATTAGCAAAACGCCCCCGGGAAAATACTGCGTTCGATATGCTGTTGAAGCCAATGAGGAGCCTGGCGTACAG
CTATGCGAAGATTGCTCAGACTTTCAAGGCTTCATCAACTCGCCCACCATATACGGAACCGTTACCGACAGATTT
CTAGTCCGCGACAATGGCACAGACTTGGCAAAAGTCCATGATCTTCAGGACCATTCATTCTTGATATACCCAATT
GTTCGCAACACTCCACATAGACTGCAAGCACCACCGCTCAGCCAAGACGTGCTCGACTCTTGCCTGTCCAATGAC
ACGCCGACAAAAATCATGCAATTGCTGGCCCGTCTAGCACCCTACAACCCGTCTCGCAACATCTCGGATCTAAAT
CGAGTCAACACCATGTTAAACAGGGCGGGTATATGCGACGGCGACTATACTCTTCCTCCAGGAGTCGACTTGGCC
AAAGTTGCTGAACAGGCTAACAAATCAGTTGTCGCGCAAGCTGTCAAGCCTGAAAATATTGTCAACGTGGGAAAT
GGCTGGTCTTCACTGGCTCCTTCGGCACAAGGAGACTACTACATAGACTACAAGATGCGCGCCTATGTGGCCAAG
ATAGGATACTTGGCTCTGGTGCCTACCGAGGCCCTGTACCCCTCACGGCGTGATTCGTCTGGCAGTACTTCGCTC
AATATCGGACCAAGAGAGGCCTACATCATCACATTTGTCGACGGCAGTCCTCCACTAGCCCCTCTTGGATTTTGG
AGCATGACGGCCTATAATGGCGACCAGTTTCTGGTGCCGAATGATTTAAACCGATACTCGCTTGGCGACCGATCC
AGCTTGACTTATCCTGATGGTTCATCTGTGTCTGAGGGCGGTACCCAGAAGAGAGCCTTTCAGATTCTCGTACAG
CCAGCAGATGTTGCTCCCCCATCAAACTGGACCTCAAAGTCGGTTTTCGTCTCCTTTGAAATGAATTCCAGCTAA
Transcript >OphauG2|513
ATGTTGTCTCTCTGCACCGCGCTGCAGGCGCTTTTGCTGCCGGGTATGGCTTGCTTCTCTTTTGCTAAAGCTGAT
GCTACAGTGGACGAGGCGACTGAATTTTCATTAATTTACGGCTATCCTCTTCTCGCTTATTCCGACTCGGCTGTT
CCCCTTTTCGAAGACGGATTAGGACCCCAAGAGTTCCTCAAGAAGCGAAAACTCGCAGGCCCAGAGGACAAGTCC
GTTGTACGACCGAATTCCGATACGCTGTATTCCATGTCTCTCCTAGACCTGTCGTGCGATGATGTTGTTGTCGAG
GTTCCCAACGTTACGGATCGATACTGGGTTGAGTCATTCTATGACATGTATGGAAACAACTATGCCAATCTAGGA
CCAATTAGCAAAACGCCCCCGGGAAAATACTGCGTTCGATATGCTGTTGAAGCCAATGAGGAGCCTGGCGTACAG
CTATGCGAAGATTGCTCAGACTTTCAAGGCTTCATCAACTCGCCCACCATATACGGAACCGTTACCGACAGATTT
CTAGTCCGCGACAATGGCACAGACTTGGCAAAAGTCCATGATCTTCAGGACCATTCATTCTTGATATACCCAATT
GTTCGCAACACTCCACATAGACTGCAAGCACCACCGCTCAGCCAAGACGTGCTCGACTCTTGCCTGTCCAATGAC
ACGCCGACAAAAATCATGCAATTGCTGGCCCGTCTAGCACCCTACAACCCGTCTCGCAACATCTCGGATCTAAAT
CGAGTCAACACCATGTTAAACAGGGCGGGTATATGCGACGGCGACTATACTCTTCCTCCAGGAGTCGACTTGGCC
AAAGTTGCTGAACAGGCTAACAAATCAGTTGTCGCGCAAGCTGTCAAGCCTGAAAATATTGTCAACGTGGGAAAT
GGCTGGTCTTCACTGGCTCCTTCGGCACAAGGAGACTACTACATAGACTACAAGATGCGCGCCTATGTGGCCAAG
ATAGGATACTTGGCTCTGGTGCCTACCGAGGCCCTGTACCCCTCACGGCGTGATTCGTCTGGCAGTACTTCGCTC
AATATCGGACCAAGAGAGGCCTACATCATCACATTTGTCGACGGCAGTCCTCCACTAGCCCCTCTTGGATTTTGG
AGCATGACGGCCTATAATGGCGACCAGTTTCTGGTGCCGAATGATTTAAACCGATACTCGCTTGGCGACCGATCC
AGCTTGACTTATCCTGATGGTTCATCTGTGTCTGAGGGCGGTACCCAGAAGAGAGCCTTTCAGATTCTCGTACAG
CCAGCAGATGTTGCTCCCCCATCAAACTGGACCTCAAAGTCGGTTTTCGTCTCCTTTGAAATGAATTCCAGCTAA
Gene >OphauG2|513
ATGTTGTCTCTCTGCACCGCGCTGCAGGCGCTTTTGCTGCCGGGTATGGCTTGCTTCTCTTTTGCTAAAGCTGAT
GCTACAGTGGACGAGGCGACTGAATTTTCATTAATTGTATCTACCAAGACTGCTTTGACGTCAAGAATTGCATAC
TAACCTGAGCGTTTAGTACGGCTATCCTCTTCTCGCTTATTCCGACTCGGCTGTTCCCCTTTTCGAAGACGGATT
AGGACCCCAAGAGTTCCTCAAGAAGCGAAAACTCGCAGGCCCAGAGGACAAGTCCGTTGTACGACCGAATTCCGA
TACGCTGTATTCCATGTCTCTCCTAGACCTGTCGTGCGATGATGTTGTTGTCGAGGTTCCCAACGTTACGGATCG
ATACTGGGTTGAGTCATTCTATGACATGTGAGTATTTTGGCGCTCAAATACAACCGAGTTTAGCATGCCACCAAA
GATTGAAGGCTCAAGTATGCTAGGTATGGAAACAACTATGCCAATCTAGGACCAATTAGCAAAACGCCCCCGGGA
AAATACTGCGTTCGATATGCTGTTGAAGCCAATGAGGAGCCTGGCGTACAGCTATGCGAAGATTGCTCAGACTTT
CAAGGCTTCATCAACTCGCCCACCATATACGGAACCGTTACCGACAGATTTCTAGTCCGCGACAATGGCACAGAC
TTGGCAAAAGTCCATGATCTTCAGGACCATTCATTCTTGATATACCCAATTGTTCGCAACACTCCACATAGACTG
CAAGCACCACCGCTCAGCCAAGACGTGCTCGACTCTTGCCTGTCCAATGACACGCCGACAAAAATCATGCAATTG
CTGGCCCGTCTAGCACCCTACAACCCGTCTCGCAACATCTCGGATCTAAATCGAGTCAACACCATGTTAAACAGG
GCGGGTATATGCGACGGCGACTATACTCTTCCTCCAGGAGTCGACTTGGCCAAAGTTGCTGAACAGGCTAACAAA
TCAGTTGTCGCGCAAGCTGTCAAGCCTGAAAATATTGTCAACGTGGGAAATGGCTGGTCTTCACTGGCTCCTTCG
GCACAAGGAGACTACTACATAGACTACAAGATGCGCGCCTATGTGGCCAAGATAGGATACTTGGCTCTGGTGCCT
ACCGAGGCCCTGTACCCCTCACGGCGTGATTCGTCTGGCAGTACTTCGCTCAATATCGGACCAAGAGAGGCCTAC
ATCATCACATTTGTCGACGGCAGTCCTCCACTAGCCCCTCTTGGATTTTGGAGCATGACGGCCTATAATGGCGAC
CAGTTTCTGGTGCCGAATGATTTAAACCGATACTCGCTTGGCGACCGATCCAGCTTGACTTATCCTGATGGTTCA
TCTGTGTCTGAGGGCGGTACCCAGAAGAGAGCCTTTCAGATTCTCGTACAGCCAGCAGATGTTGCTCCCCCATCA
AACTGGACCTCAAAGTCGGTTTTCGTCTCCTTTGAAATGAATTCCAGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail