Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|511
Gene name
LocationContig_1119:3432..5527
Strand-
Gene length (bp)2095
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12014 Cyclin_D1_bind Cyclin D1 binding domain 7.5E-26 414 543
PF00646 F-box F-box domain 3.9E-04 112 144

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4555
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|511 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2475
Ophiocordyceps camponoti-floridani Ophcf2|00056
Ophiocordyceps camponoti-rufipedis Ophun1|616
Ophiocordyceps kimflemingae Ophio5|2544
Ophiocordyceps subramaniannii Hirsu2|9527

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|511
MADGGPQWCAADDNEQDAEELPSTKPSRLESSWQTVSSTAQMSLLGCPWTPVHVSQPRTNTVPPQQAYIDDTTLT
SHADTCPPPPPPPPPPTTTAATTATDAMAPRRCLLQLLPPELIDSILAHLPPCDLAVVSACCSLLRKHALADGHW
RRCVEQNVPCQELEGPGPCASFRELYASHDLVWFLPRHKVWFCDRDLTGRLMIARFDARRGCIEGYQLLAVRRRT
SVEQWAADNQVVIHHFEPHVKLHLDKPVLHFGLRGPGKGSSSSRPRRGGNRFADEMPLALADRTGALFCNFLLTR
AIDINTLGYAARGFPYDNVWPPPTVPASHRVAGAHSGQAVVDLSPNDHPRTRAQVSDRCFRIRQWMQMSGSPPPL
FSAGVSPVSGFDAFSHVLGSMTHHPGPEGIHIGEEIITYATLDPVCYTPTPTRPWRGIWVGDYSGHGCEFLLFNQ
PDEPPVTDAQLSLVRGQDESQAAWQQRRLHARIYRGRLEGIKLTGDPSVPRGEYTFVAPDLGRDGQVGVATEPPF
TGAVIVQSKGHVAGTGFVDV*
Coding >OphauG2|511
ATGGCTGACGGCGGCCCTCAATGGTGTGCAGCTGACGACAATGAACAAGATGCCGAGGAGCTGCCGTCAACAAAA
CCATCACGTCTAGAATCGTCGTGGCAGACAGTCTCTAGCACGGCCCAAATGTCGCTTCTCGGCTGTCCTTGGACC
CCGGTCCATGTCTCGCAGCCCAGGACAAACACTGTGCCGCCGCAACAAGCTTATATCGACGACACGACTCTGACT
AGTCATGCGGATACTTGCCCCCCTCCTCCGCCTCCGCCTCCTCCTCCTACTACTACTGCTGCTACTACTGCTACT
GACGCCATGGCGCCGCGACGCTGCTTGTTGCAGCTTCTCCCGCCCGAGCTCATTGACAGCATTCTCGCCCACCTG
CCGCCCTGCGATTTGGCCGTCGTGTCGGCCTGCTGCTCGCTGCTGCGGAAACACGCCCTGGCGGATGGGCACTGG
CGGCGGTGCGTGGAGCAAAACGTGCCGTGCCAGGAGCTCGAGGGGCCGGGCCCGTGTGCAAGTTTCCGCGAGCTG
TACGCCAGCCACGACTTGGTGTGGTTTTTGCCGCGGCATAAAGTGTGGTTTTGCGATCGCGACTTGACGGGCCGG
TTGATGATTGCTCGCTTTGATGCGCGCCGCGGCTGTATCGAGGGCTATCAGTTGCTGGCAGTGCGGCGACGGACC
TCGGTTGAGCAGTGGGCTGCGGACAACCAGGTGGTGATTCATCACTTTGAGCCTCATGTCAAGCTGCATCTTGAT
AAGCCCGTCTTGCACTTTGGCCTGCGTGGCCCGGGAAAGGGGAGCAGTAGCTCGCGCCCGAGGCGTGGGGGAAAC
CGCTTCGCTGATGAGATGCCGTTGGCGCTGGCTGACCGCACCGGGGCCCTGTTTTGCAACTTTCTCCTGACGCGG
GCCATTGACATCAACACGCTTGGCTACGCTGCTCGCGGCTTTCCCTACGACAATGTCTGGCCGCCGCCAACAGTG
CCCGCCAGCCATCGTGTTGCGGGAGCGCACTCCGGCCAGGCTGTTGTCGACTTGTCGCCCAATGACCATCCCAGG
ACGCGAGCCCAAGTCTCTGACCGATGCTTTCGCATCAGGCAATGGATGCAAATGTCTGGCTCCCCCCCTCCCCTC
TTCTCTGCTGGAGTCAGCCCCGTCTCGGGCTTTGACGCCTTTTCCCACGTCCTCGGCAGCATGACGCATCATCCC
GGGCCCGAGGGCATCCACATTGGCGAGGAAATCATCACGTACGCCACTCTCGACCCCGTCTGCTACACCCCCACG
CCCACCCGGCCCTGGCGCGGCATCTGGGTCGGCGACTACAGCGGCCACGGCTGCGAGTTTTTGCTCTTCAACCAG
CCAGACGAGCCGCCCGTCACCGACGCCCAGCTCAGCCTGGTGCGCGGCCAAGACGAATCCCAGGCCGCCTGGCAG
CAGCGGAGGCTCCATGCCCGCATCTACCGCGGCAGGCTCGAGGGCATCAAGCTCACTGGCGATCCCAGCGTCCCC
CGCGGCGAGTACACCTTTGTCGCCCCAGACCTCGGCCGCGACGGCCAGGTTGGCGTCGCCACCGAGCCGCCATTT
ACCGGCGCCGTCATTGTCCAAAGCAAAGGCCACGTTGCCGGCACTGGCTTTGTCGACGTTTGA
Transcript >OphauG2|511
ATGGCTGACGGCGGCCCTCAATGGTGTGCAGCTGACGACAATGAACAAGATGCCGAGGAGCTGCCGTCAACAAAA
CCATCACGTCTAGAATCGTCGTGGCAGACAGTCTCTAGCACGGCCCAAATGTCGCTTCTCGGCTGTCCTTGGACC
CCGGTCCATGTCTCGCAGCCCAGGACAAACACTGTGCCGCCGCAACAAGCTTATATCGACGACACGACTCTGACT
AGTCATGCGGATACTTGCCCCCCTCCTCCGCCTCCGCCTCCTCCTCCTACTACTACTGCTGCTACTACTGCTACT
GACGCCATGGCGCCGCGACGCTGCTTGTTGCAGCTTCTCCCGCCCGAGCTCATTGACAGCATTCTCGCCCACCTG
CCGCCCTGCGATTTGGCCGTCGTGTCGGCCTGCTGCTCGCTGCTGCGGAAACACGCCCTGGCGGATGGGCACTGG
CGGCGGTGCGTGGAGCAAAACGTGCCGTGCCAGGAGCTCGAGGGGCCGGGCCCGTGTGCAAGTTTCCGCGAGCTG
TACGCCAGCCACGACTTGGTGTGGTTTTTGCCGCGGCATAAAGTGTGGTTTTGCGATCGCGACTTGACGGGCCGG
TTGATGATTGCTCGCTTTGATGCGCGCCGCGGCTGTATCGAGGGCTATCAGTTGCTGGCAGTGCGGCGACGGACC
TCGGTTGAGCAGTGGGCTGCGGACAACCAGGTGGTGATTCATCACTTTGAGCCTCATGTCAAGCTGCATCTTGAT
AAGCCCGTCTTGCACTTTGGCCTGCGTGGCCCGGGAAAGGGGAGCAGTAGCTCGCGCCCGAGGCGTGGGGGAAAC
CGCTTCGCTGATGAGATGCCGTTGGCGCTGGCTGACCGCACCGGGGCCCTGTTTTGCAACTTTCTCCTGACGCGG
GCCATTGACATCAACACGCTTGGCTACGCTGCTCGCGGCTTTCCCTACGACAATGTCTGGCCGCCGCCAACAGTG
CCCGCCAGCCATCGTGTTGCGGGAGCGCACTCCGGCCAGGCTGTTGTCGACTTGTCGCCCAATGACCATCCCAGG
ACGCGAGCCCAAGTCTCTGACCGATGCTTTCGCATCAGGCAATGGATGCAAATGTCTGGCTCCCCCCCTCCCCTC
TTCTCTGCTGGAGTCAGCCCCGTCTCGGGCTTTGACGCCTTTTCCCACGTCCTCGGCAGCATGACGCATCATCCC
GGGCCCGAGGGCATCCACATTGGCGAGGAAATCATCACGTACGCCACTCTCGACCCCGTCTGCTACACCCCCACG
CCCACCCGGCCCTGGCGCGGCATCTGGGTCGGCGACTACAGCGGCCACGGCTGCGAGTTTTTGCTCTTCAACCAG
CCAGACGAGCCGCCCGTCACCGACGCCCAGCTCAGCCTGGTGCGCGGCCAAGACGAATCCCAGGCCGCCTGGCAG
CAGCGGAGGCTCCATGCCCGCATCTACCGCGGCAGGCTCGAGGGCATCAAGCTCACTGGCGATCCCAGCGTCCCC
CGCGGCGAGTACACCTTTGTCGCCCCAGACCTCGGCCGCGACGGCCAGGTTGGCGTCGCCACCGAGCCGCCATTT
ACCGGCGCCGTCATTGTCCAAAGCAAAGGCCACGTTGCCGGCACTGGCTTTGTCGACGTTTGA
Gene >OphauG2|511
ATGGCTGACGGCGGCCCTCAATGGTGTGCAGCTGACGACAATGAACAAGATGCCGAGGAGCTGCCGTCAACAAAA
CCATCACGTCTAGAATCGTCGTGGCAGACAGTCTCTAGCACGGCCCAAATGTCGCTTCTCGGCTGTCCTTGGACC
CCGGTCCATGTCTCGCAGCCCAGGACAAACACTGTGCCGCCGCAACAAGCTTATATCGACGACACGACTCTGACT
AGTCATGCGGATACTTGCCCCCCTCCTCCGCCTCCGCCTCCTCCTCCTACTACTACTGCTGCTACTACTGCTACT
GACGCCATGGCGCCGCGACGCTGCTTGTTGCAGCTTCTCCCGCCCGAGCTCATTGACAGCATTCTCGCCCACCTG
CCGCCCTGCGATTTGGCCGTCGTGTCGGCCTGCTGCTCGCTGCTGCGGAAACACGCCCTGGCGGATGGGCACTGG
CGGCGGTGCGTGGAGCAAAACGTGCCGTGCCAGGAGCTCGAGGGGCCGGGCCCGTGTGCAAGTTTCCGCGAGCTG
TACGCCAGCCACGACTTGGTGTGGTTTTTGCCGCGGCATAAAGTGTGGTTTTGCGATCGCGACTTGACGGGCCGG
TTGATGATTGCTCGCTTTGATGCGCGCCGCGGCTGTATCGAGGGCTATCAGTTGCTGGCAGTGCGGCGACGGACC
TCGGTTGAGCAGTGGGCTGCGGACAACCAGGTGGTGATTCATCACTTTGAGCCTCATGTCAAGCTGCATCTTGAT
AAGCCCGTCTTGCACTTTGGCCTGCGTGGCCCGGGAAAGGGGAGCAGTAGCTCGCGCCCGAGGCGTGGGGGAAAC
CGCTTCGCTGATGAGATGCCGTTGGCGCTGGCTGACCGCACCGGGGCCCTGTTTTGCAACTTTCTCCTGACGCGG
GCCATTGACATCAACACGCTTGGCTACGCTGCTCGCGGCTTTCCCTACGACAATGTCTGGCCGCCGCCAACAGTG
CCCGCCAGCCATCGTGTTGCGGGAGCGCACTCCGGCCAGGCTGTTGTCGACTTGTCGCCCAATGACCATCCCAGG
ACGCGAGCCCAAGTCTCTGACCGATGCTTTCGCATCAGGCAATGGATGCAAATGTCTGGCTCCCCCCCTCCCCTC
TTCTCTGCTGGAGTCAGCCCCGTCTCGGGCTTTGACGCCTTTTCCCACGTCCTCGGCAGCATGACGCATCATCCC
GGGCCCGAGGGCATCCACATTGGCGAGGAAATCATCACGTACGCCACTCTCGACCCCGTCTGCTACACCCCCACG
CCCACCCGGCCCTGGCGCGGCATCTGGGTCGGCGACTACAGCGGCCACGGCTGCGAGTTTTTGCTCTTCAACCAG
CCAGACGAGCCGCCCGTCACCGACGCCCAGCTCAGCCTGGTGCGCGGCCAAGACGAATCCCAGGCCGCCTGGCAG
CAGCGGAGGCTCCATGCCCGCATCTACCGCGGCAGGCTCGAGGGCATCAAGCTCACTGGCGATCCCAGCGTCCCC
CGCGGCGAGTACACCTTTGTCGCCCCAGACCTCGGCCGCGACGGCCAGGTTGGCGTCGCCACCGAGCCGCCATTT
ACCGGCGCCGTCATTGTCCAAAGCAAAGGCCACGTTGCCGGCACTGGCTTTGTCGACGGTCAGCTCTGCTTCCTT
GCCTCCCTTTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCT
TCTCTCTTTCCCTCTTTTATACATCATGAGCGACGCATCACGACGAATGTCTATAAACGGAAAAAAAAAAAGGTT
TGGTCTTATGAAGAAAAAGAAGAAGAAACAGAGTATTAGTACTTTGCACACGTGCCAGTTACAAGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail