Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5101
Gene name
LocationContig_453:10695..14537
Strand-
Gene length (bp)3842
Transcript length (bp)3567
Coding sequence length (bp)3567
Protein length (aa) 1189

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12922 Cnd1_N non-SMC mitotic condensation complex subunit 1, N-term 1.0E-61 86 249
PF12717 Cnd1 non-SMC mitotic condensation complex subunit 1 1.4E-44 1004 1163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94679|CND1_SCHPO Condensin complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnd1 PE=1 SV=1 4 1181 0.0E+00
sp|Q06156|CND1_YEAST Condensin complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCS4 PE=1 SV=1 123 1185 0.0E+00
sp|Q9YHY6|CND1_XENLA Condensin complex subunit 1 OS=Xenopus laevis GN=ncapd2 PE=1 SV=1 505 1175 6.0E-98
sp|Q8K2Z4|CND1_MOUSE Condensin complex subunit 1 OS=Mus musculus GN=Ncapd2 PE=1 SV=2 537 1167 1.0E-84
sp|Q15021|CND1_HUMAN Condensin complex subunit 1 OS=Homo sapiens GN=NCAPD2 PE=1 SV=3 521 1167 9.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94679|CND1_SCHPO Condensin complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnd1 PE=1 SV=1 4 1181 0.0E+00
sp|Q06156|CND1_YEAST Condensin complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCS4 PE=1 SV=1 123 1185 0.0E+00
sp|Q9YHY6|CND1_XENLA Condensin complex subunit 1 OS=Xenopus laevis GN=ncapd2 PE=1 SV=1 505 1175 6.0E-98
sp|Q8K2Z4|CND1_MOUSE Condensin complex subunit 1 OS=Mus musculus GN=Ncapd2 PE=1 SV=2 537 1167 1.0E-84
sp|Q15021|CND1_HUMAN Condensin complex subunit 1 OS=Homo sapiens GN=NCAPD2 PE=1 SV=3 521 1167 9.0E-84
sp|Q9YHY6|CND1_XENLA Condensin complex subunit 1 OS=Xenopus laevis GN=ncapd2 PE=1 SV=1 171 472 1.0E-31
sp|Q8K2Z4|CND1_MOUSE Condensin complex subunit 1 OS=Mus musculus GN=Ncapd2 PE=1 SV=2 203 444 6.0E-27
sp|Q15021|CND1_HUMAN Condensin complex subunit 1 OS=Homo sapiens GN=NCAPD2 PE=1 SV=3 203 444 7.0E-27
sp|Q6ZQK0|CNDD3_MOUSE Condensin-2 complex subunit D3 OS=Mus musculus GN=Ncapd3 PE=1 SV=3 967 1184 2.0E-06
sp|P42695|CNDD3_HUMAN Condensin-2 complex subunit D3 OS=Homo sapiens GN=NCAPD3 PE=1 SV=2 967 1103 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5101
MGSVNFDINDALKHYMSDPATIATPEADGSLFDCENEPESLTDAVVDPVLNAVIDAVADNPSAIMRAAYIDSLQF
CLKYASSLSTHALSKIFDLVMSGLSAETDTAHHDLESTDGQDALEHHKQLLEIYGFLVQWVVAAVEAKAAEKPST
AAPTARARGKPKKSAQADNQWNSVAQLQSALDIMCKVLKLKLSKIFLTTSERDTFVGLLTRPVYMVMESEQRAKS
MPIRMHCFKVLCMAIKHHGHGYAAQINVIQNLTYFEHLSEPMAELLHILAETYDYPQLADEVLREISNKEFNSND
TRGPKSVSSFITKLSELAPRLVIKQMTMLAKQLDSESYTLRCALIEVCGNMIIHLSKQDERGESFKTQLNAFFDV
LEERFLDINPYCRCRALQVYMRICELEQKFPKRRQRAAELACQSLEDKSSNVRRNAIKLLGSLITTHPFVLMNGA
QLSRKDWQARHDKVEEELNALKPPPGMPSFGDNSTSVDKELLDDATQVGSPEKPKPMTEEEKAEAIRKAQQEAAT
SEAIEKLTLTRRYHSEALKFINVLHDATAIICQLLGSRNKSEVIEAMDYFVIGDAYNVEQVKIGIRRMLRLIWTK
GNSDEGKGVQTHLIECYRKLFFEAPESFSENDTANYIARNMISLTFGATPAELTSLEQLLATMMKAGIMSDLVVS
KLWQVYGVQRREISKTQRRGAIIVLGMLATANPEIVVGEIETMLQTGLGVHGHNDLQLAKYTCIALRRINPTGRQ
AKEPGPKFARLANDHAVPARLAAITQVSSDSNEWYGLAEQAINAIYAISKHPDTLCSDIIKLKTRRIFGGLEPSS
GQSSRPTSRDETKMLSQDNQEMMSRAVEQPRTRNDIIGLSQLLFIVGHVAIKQIVHLELCELDFKRRKQEKEKQA
SAKSDKEKEDADEMDLIGGTSEDDFTEAMAHIRERELLYGPSSLLGLFGPLVSEICANNTTYAEAGLQAAATLCL
AKLMCVSAEYCETNLPLLITIMERSPDATVRSNAVIALGDMAVCFNHLIDENTDFLYRRLADDDASVKRTCLMTL
TFLILAGQVKVKGQLGEMAKCLEDSDRRIADLARMFFTELSTKDNAVYNHFVDMFSLLSADANMDEDVFRRIIRF
LLGFVEKDKHAKQLAEKLAARLARCETERQWNDVAFALGLLPHKNEEIAKTVAEGFKVVATSA*
Coding >OphauG2|5101
ATGGGGAGCGTCAACTTTGATATCAATGATGCGCTCAAGCATTACATGTCGGATCCCGCCACGATTGCGACTCCC
GAGGCGGATGGCTCTCTCTTTGACTGCGAAAATGAGCCCGAGTCGCTGACGGATGCCGTTGTCGACCCGGTTCTG
AATGCCGTTATAGATGCTGTGGCTGACAACCCAAGCGCAATTATGCGCGCCGCGTACATCGACTCGCTGCAGTTT
TGCCTCAAATATGCATCCTCTCTGTCGACGCACGCGCTGAGCAAAATCTTTGATCTTGTCATGAGCGGCTTGAGC
GCCGAAACCGACACAGCACACCACGATCTCGAGTCCACAGACGGGCAAGACGCGCTGGAGCATCACAAGCAGCTT
CTCGAAATATACGGCTTCCTCGTGCAATGGGTCGTTGCCGCAGTAGAGGCCAAGGCTGCGGAAAAGCCGTCCACT
GCCGCGCCGACAGCCCGCGCGCGCGGAAAGCCCAAGAAGAGCGCCCAGGCAGACAATCAGTGGAATTCTGTCGCG
CAATTGCAGTCTGCCCTCGATATCATGTGCAAAGTGCTGAAGCTGAAGCTGTCCAAAATCTTCCTGACGACGAGT
GAGAGGGACACGTTTGTCGGCCTACTGACAAGACCAGTCTACATGGTGATGGAGAGCGAGCAGCGGGCCAAGTCT
ATGCCCATTCGCATGCATTGTTTCAAAGTGCTCTGCATGGCCATTAAGCATCACGGCCATGGTTATGCCGCACAA
ATCAATGTTATTCAAAATCTCACCTACTTTGAGCACTTGTCAGAGCCCATGGCGGAACTGTTGCACATCTTGGCC
GAGACGTACGATTACCCTCAGCTGGCCGACGAAGTCTTGCGAGAAATAAGCAATAAGGAATTCAACTCAAACGAC
ACACGAGGCCCCAAGTCTGTCTCTTCCTTCATCACTAAGCTGTCAGAACTTGCGCCACGGTTGGTCATTAAGCAG
ATGACAATGCTCGCAAAGCAGCTCGACAGCGAGTCCTACACACTGCGCTGTGCTTTGATAGAGGTTTGCGGTAAC
ATGATTATCCATCTCAGCAAGCAGGACGAGCGTGGCGAAAGCTTCAAGACGCAGCTTAATGCCTTCTTTGACGTT
TTGGAAGAGCGTTTCCTTGACATTAATCCCTACTGCCGCTGCCGTGCGTTGCAGGTGTACATGAGAATTTGCGAA
CTGGAGCAAAAATTCCCCAAGCGCCGGCAACGAGCAGCAGAGCTTGCTTGCCAAAGCCTAGAGGATAAGAGCAGC
AACGTGCGGCGCAACGCCATCAAGTTGCTCGGGTCTCTCATCACAACTCATCCCTTTGTTCTAATGAATGGCGCT
CAGCTCTCTCGCAAGGATTGGCAAGCTCGCCACGACAAGGTGGAAGAGGAGCTCAATGCGCTCAAACCTCCTCCA
GGCATGCCAAGCTTTGGAGACAATTCCACCTCTGTAGACAAGGAGCTGCTTGACGACGCGACCCAAGTTGGCTCG
CCCGAGAAGCCCAAGCCTATGACGGAAGAGGAAAAGGCGGAAGCCATCAGGAAGGCCCAGCAAGAGGCGGCCACG
AGCGAAGCCATTGAAAAGCTGACGCTGACGCGCCGATACCACAGCGAAGCGCTCAAGTTCATCAATGTCTTGCAC
GATGCCACTGCCATCATCTGCCAACTGCTGGGTTCGCGCAATAAGAGCGAGGTGATTGAAGCAATGGACTATTTC
GTCATTGGCGACGCATACAACGTCGAGCAGGTCAAAATTGGCATCCGGCGCATGCTGCGGCTCATTTGGACCAAG
GGCAACAGCGACGAGGGCAAGGGAGTGCAGACTCACTTGATAGAGTGCTACCGAAAGCTCTTCTTCGAAGCGCCC
GAGTCGTTTAGTGAAAACGACACGGCCAACTACATTGCTCGCAACATGATCAGCTTGACGTTTGGCGCCACGCCT
GCGGAGCTGACCTCGCTGGAGCAGTTGCTCGCAACCATGATGAAGGCTGGCATCATGTCCGACTTGGTCGTCTCC
AAGCTGTGGCAAGTGTATGGAGTGCAGAGACGCGAGATTTCCAAGACTCAGCGAAGGGGCGCCATTATTGTGCTC
GGCATGCTAGCCACGGCCAACCCCGAGATTGTTGTGGGCGAAATCGAGACGATGCTCCAAACCGGCCTTGGAGTC
CATGGCCACAACGACTTGCAGCTGGCAAAGTACACGTGCATTGCTCTTAGAAGGATCAATCCAACGGGTCGGCAA
GCCAAGGAGCCTGGGCCAAAGTTTGCGCGCCTGGCCAACGACCACGCTGTGCCCGCAAGACTGGCAGCCATTACC
CAAGTGTCGTCGGACAGCAATGAGTGGTACGGACTTGCGGAGCAGGCCATTAATGCCATCTATGCCATTTCCAAG
CACCCGGACACGCTCTGCTCCGATATCATCAAGCTCAAGACGCGGAGGATATTTGGCGGCTTGGAGCCGTCGTCA
GGGCAATCGTCGCGCCCCACGTCACGCGATGAAACCAAGATGCTGAGCCAAGACAACCAGGAGATGATGAGCCGG
GCGGTGGAACAACCAAGGACGCGGAACGACATCATTGGTCTTTCCCAGCTCCTATTCATCGTTGGGCACGTTGCC
ATTAAGCAAATTGTGCATCTCGAGCTTTGCGAGCTTGACTTTAAGCGCAGAAAACAGGAAAAGGAAAAGCAAGCC
AGCGCCAAGTCGGACAAGGAAAAGGAGGATGCTGATGAGATGGACCTCATTGGCGGGACGTCGGAAGACGACTTT
ACCGAAGCCATGGCTCACATTCGCGAGCGCGAGCTCTTGTATGGCCCCAGCTCCTTGCTGGGGCTTTTTGGACCC
TTGGTATCCGAGATTTGCGCCAACAACACCACCTATGCTGAAGCGGGCTTGCAGGCCGCCGCGACGCTATGCCTG
GCCAAGCTCATGTGTGTATCGGCCGAGTACTGCGAGACCAACCTCCCCCTGCTCATCACAATCATGGAGCGGTCG
CCCGACGCCACGGTGCGGTCCAATGCTGTGATTGCGCTGGGCGACATGGCGGTCTGTTTCAACCATTTGATTGAC
GAAAACACCGACTTTTTGTATCGGCGCCTGGCGGATGACGACGCCTCGGTCAAGCGAACCTGCCTAATGACGCTC
ACCTTTCTCATCCTGGCGGGCCAGGTCAAGGTCAAGGGCCAGCTAGGCGAGATGGCAAAGTGTCTCGAGGACAGC
GATAGGCGGATAGCCGACTTGGCGCGCATGTTTTTTACGGAGCTGAGCACCAAGGACAATGCAGTGTATAATCAC
TTTGTCGACATGTTTAGTCTGTTGAGTGCGGATGCCAATATGGATGAGGATGTGTTTCGGCGCATTATCCGCTTC
CTGCTGGGATTTGTTGAAAAGGACAAGCATGCAAAGCAACTGGCTGAAAAGTTGGCGGCGAGGTTGGCGCGGTGC
GAGACGGAGAGGCAGTGGAACGACGTGGCCTTTGCGCTGGGCCTGCTGCCGCACAAGAATGAAGAGATTGCAAAG
ACGGTGGCAGAGGGATTCAAGGTTGTGGCTACGAGTGCTTAG
Transcript >OphauG2|5101
ATGGGGAGCGTCAACTTTGATATCAATGATGCGCTCAAGCATTACATGTCGGATCCCGCCACGATTGCGACTCCC
GAGGCGGATGGCTCTCTCTTTGACTGCGAAAATGAGCCCGAGTCGCTGACGGATGCCGTTGTCGACCCGGTTCTG
AATGCCGTTATAGATGCTGTGGCTGACAACCCAAGCGCAATTATGCGCGCCGCGTACATCGACTCGCTGCAGTTT
TGCCTCAAATATGCATCCTCTCTGTCGACGCACGCGCTGAGCAAAATCTTTGATCTTGTCATGAGCGGCTTGAGC
GCCGAAACCGACACAGCACACCACGATCTCGAGTCCACAGACGGGCAAGACGCGCTGGAGCATCACAAGCAGCTT
CTCGAAATATACGGCTTCCTCGTGCAATGGGTCGTTGCCGCAGTAGAGGCCAAGGCTGCGGAAAAGCCGTCCACT
GCCGCGCCGACAGCCCGCGCGCGCGGAAAGCCCAAGAAGAGCGCCCAGGCAGACAATCAGTGGAATTCTGTCGCG
CAATTGCAGTCTGCCCTCGATATCATGTGCAAAGTGCTGAAGCTGAAGCTGTCCAAAATCTTCCTGACGACGAGT
GAGAGGGACACGTTTGTCGGCCTACTGACAAGACCAGTCTACATGGTGATGGAGAGCGAGCAGCGGGCCAAGTCT
ATGCCCATTCGCATGCATTGTTTCAAAGTGCTCTGCATGGCCATTAAGCATCACGGCCATGGTTATGCCGCACAA
ATCAATGTTATTCAAAATCTCACCTACTTTGAGCACTTGTCAGAGCCCATGGCGGAACTGTTGCACATCTTGGCC
GAGACGTACGATTACCCTCAGCTGGCCGACGAAGTCTTGCGAGAAATAAGCAATAAGGAATTCAACTCAAACGAC
ACACGAGGCCCCAAGTCTGTCTCTTCCTTCATCACTAAGCTGTCAGAACTTGCGCCACGGTTGGTCATTAAGCAG
ATGACAATGCTCGCAAAGCAGCTCGACAGCGAGTCCTACACACTGCGCTGTGCTTTGATAGAGGTTTGCGGTAAC
ATGATTATCCATCTCAGCAAGCAGGACGAGCGTGGCGAAAGCTTCAAGACGCAGCTTAATGCCTTCTTTGACGTT
TTGGAAGAGCGTTTCCTTGACATTAATCCCTACTGCCGCTGCCGTGCGTTGCAGGTGTACATGAGAATTTGCGAA
CTGGAGCAAAAATTCCCCAAGCGCCGGCAACGAGCAGCAGAGCTTGCTTGCCAAAGCCTAGAGGATAAGAGCAGC
AACGTGCGGCGCAACGCCATCAAGTTGCTCGGGTCTCTCATCACAACTCATCCCTTTGTTCTAATGAATGGCGCT
CAGCTCTCTCGCAAGGATTGGCAAGCTCGCCACGACAAGGTGGAAGAGGAGCTCAATGCGCTCAAACCTCCTCCA
GGCATGCCAAGCTTTGGAGACAATTCCACCTCTGTAGACAAGGAGCTGCTTGACGACGCGACCCAAGTTGGCTCG
CCCGAGAAGCCCAAGCCTATGACGGAAGAGGAAAAGGCGGAAGCCATCAGGAAGGCCCAGCAAGAGGCGGCCACG
AGCGAAGCCATTGAAAAGCTGACGCTGACGCGCCGATACCACAGCGAAGCGCTCAAGTTCATCAATGTCTTGCAC
GATGCCACTGCCATCATCTGCCAACTGCTGGGTTCGCGCAATAAGAGCGAGGTGATTGAAGCAATGGACTATTTC
GTCATTGGCGACGCATACAACGTCGAGCAGGTCAAAATTGGCATCCGGCGCATGCTGCGGCTCATTTGGACCAAG
GGCAACAGCGACGAGGGCAAGGGAGTGCAGACTCACTTGATAGAGTGCTACCGAAAGCTCTTCTTCGAAGCGCCC
GAGTCGTTTAGTGAAAACGACACGGCCAACTACATTGCTCGCAACATGATCAGCTTGACGTTTGGCGCCACGCCT
GCGGAGCTGACCTCGCTGGAGCAGTTGCTCGCAACCATGATGAAGGCTGGCATCATGTCCGACTTGGTCGTCTCC
AAGCTGTGGCAAGTGTATGGAGTGCAGAGACGCGAGATTTCCAAGACTCAGCGAAGGGGCGCCATTATTGTGCTC
GGCATGCTAGCCACGGCCAACCCCGAGATTGTTGTGGGCGAAATCGAGACGATGCTCCAAACCGGCCTTGGAGTC
CATGGCCACAACGACTTGCAGCTGGCAAAGTACACGTGCATTGCTCTTAGAAGGATCAATCCAACGGGTCGGCAA
GCCAAGGAGCCTGGGCCAAAGTTTGCGCGCCTGGCCAACGACCACGCTGTGCCCGCAAGACTGGCAGCCATTACC
CAAGTGTCGTCGGACAGCAATGAGTGGTACGGACTTGCGGAGCAGGCCATTAATGCCATCTATGCCATTTCCAAG
CACCCGGACACGCTCTGCTCCGATATCATCAAGCTCAAGACGCGGAGGATATTTGGCGGCTTGGAGCCGTCGTCA
GGGCAATCGTCGCGCCCCACGTCACGCGATGAAACCAAGATGCTGAGCCAAGACAACCAGGAGATGATGAGCCGG
GCGGTGGAACAACCAAGGACGCGGAACGACATCATTGGTCTTTCCCAGCTCCTATTCATCGTTGGGCACGTTGCC
ATTAAGCAAATTGTGCATCTCGAGCTTTGCGAGCTTGACTTTAAGCGCAGAAAACAGGAAAAGGAAAAGCAAGCC
AGCGCCAAGTCGGACAAGGAAAAGGAGGATGCTGATGAGATGGACCTCATTGGCGGGACGTCGGAAGACGACTTT
ACCGAAGCCATGGCTCACATTCGCGAGCGCGAGCTCTTGTATGGCCCCAGCTCCTTGCTGGGGCTTTTTGGACCC
TTGGTATCCGAGATTTGCGCCAACAACACCACCTATGCTGAAGCGGGCTTGCAGGCCGCCGCGACGCTATGCCTG
GCCAAGCTCATGTGTGTATCGGCCGAGTACTGCGAGACCAACCTCCCCCTGCTCATCACAATCATGGAGCGGTCG
CCCGACGCCACGGTGCGGTCCAATGCTGTGATTGCGCTGGGCGACATGGCGGTCTGTTTCAACCATTTGATTGAC
GAAAACACCGACTTTTTGTATCGGCGCCTGGCGGATGACGACGCCTCGGTCAAGCGAACCTGCCTAATGACGCTC
ACCTTTCTCATCCTGGCGGGCCAGGTCAAGGTCAAGGGCCAGCTAGGCGAGATGGCAAAGTGTCTCGAGGACAGC
GATAGGCGGATAGCCGACTTGGCGCGCATGTTTTTTACGGAGCTGAGCACCAAGGACAATGCAGTGTATAATCAC
TTTGTCGACATGTTTAGTCTGTTGAGTGCGGATGCCAATATGGATGAGGATGTGTTTCGGCGCATTATCCGCTTC
CTGCTGGGATTTGTTGAAAAGGACAAGCATGCAAAGCAACTGGCTGAAAAGTTGGCGGCGAGGTTGGCGCGGTGC
GAGACGGAGAGGCAGTGGAACGACGTGGCCTTTGCGCTGGGCCTGCTGCCGCACAAGAATGAAGAGATTGCAAAG
ACGGTGGCAGAGGGATTCAAGGTTGTGGCTACGAGTGCTTAG
Gene >OphauG2|5101
ATGGGGAGCGTCAACTTTGATATCAATGATGCGCTCAAGCATTACATGTCGGATCCCGCCACGATTGCGACTCCC
GAGGCGGATGGCTCTCTCTTTGACTGCGAAAATGAGCCCGAGTCGCTGACGGATGCCGTTGTCGACCCGGTTCTG
AATGCCGTTATAGATGCTGTGGCTGACAACCCAAGCGCAATTATGCGCGCCGCGTACATCGACTCGCTGCAGTTT
TGCCTCAAGTACGTGGCTCTCTTGGCTCATGTCCTTGAGCCTTGACGCTTCTGGGTCGCGACCTTGGCTTCTCTA
ACTGGCTCGCAGATATGCATCCTCTCTGTCGACGCACGCGCTGAGCAAAATCTTTGATCTTGTCATGAGCGGCTT
GAGCGCCGAAACCGACACAGCACACCACGATCTCGAGTCCACAGACGGGCAAGACGCGCTGGAGCATCACAAGCA
GCTTCTCGAAATATACGGCTTCCTCGTGCAATGGGTCGTTGCCGCAGTAGAGGCCAAGGCTGCGGAAAAGCCGTC
CACTGCCGCGCCGACAGCCCGCGCGCGCGGAAAGCCCAAGAAGAGCGCCCAGGCAGACAATCAGTGGAATTCTGT
CGCGCAATTGCAGTCTGCCCTCGATATCATGTGCAAAGTGCTGAAGCTGAAGCTGTCCAAAATCTTCCTGACGAC
GAGTGAGAGGGACACGTTTGTCGGCCTACTGACAAGACCAGTCTACATGGTGATGGAGAGCGAGCAGCGGGCCAA
GTCTATGCCCATTCGCATGCATTGTTTCAAAGTGCTCTGCATGGCCATTAAGCATCACGGCCATGGTTATGGTAG
TTCTCGTGTCCATTCAATAGCAGATGGCTCCTCGGCTGACACGCAACACAGCCGCACAAATCAATGTTATTCAAA
ATCTCACCTACTTTGAGCACTTGTCAGAGCCCATGGCGGAACTGTTGCACATCTTGGCCGAGACGTACGATTACC
CTCAGCTGGCCGACGAAGTCTTGCGAGAAATAAGCAATAAGGAATTCAACTCAAACGACACACGAGGCCCCAAGT
CTGTCTCTTCCTTCATCACTAAGCTGTCAGAACTTGCGCCACGGTTGGTCATTAAGCAGATGACAATGCTCGCAA
AGCAGCTCGACAGCGAGGTTTGTGCTCTAGCCTGTTGCTAGTTGACAATGTACTCTGACAAATGAGCAGTCCTAC
ACACTGCGCTGTGCTTTGATAGAGGTTTGCGGTAACATGATTATCCATCTCAGCAAGCAGGACGAGCGTGGCGAA
AGCTTCAAGACGCAGCTTAATGCCTTCTTTGACGTTTTGGAAGAGCGTTTCCTTGACATTAATCCCTACTGCCGC
TGCCGTGCGTTGCAGGTGTACATGAGAATTTGCGAACTGGAGCAAAAATTCCCCAAGCGCCGGCAACGAGCAGCA
GAGCTTGCTTGCCAAAGCCTAGAGGATAAGAGCAGCAACGTGCGGCGCAACGCCATCAAGTTGCTCGGGTCTCTC
ATCACAACTCATCCCTTTGTTCTAATGAATGGCGCTCAGCTCTCTCGCAAGGATTGGCAAGCTCGCCACGACAAG
GTGGAAGAGGAGCTCAATGCGCTCAAACCTCCTCCAGGCATGCCAAGCTTTGGAGACAATTCCACCTCTGTAGAC
AAGGAGCTGCTTGACGACGCGACCCAAGTTGGCTCGCCCGAGAAGCCCAAGCCTATGACGGAAGAGGAAAAGGCG
GAAGCCATCAGGAAGGCCCAGCAAGAGGCGGCCACGAGCGAAGCCATTGAAAAGCTGACGCTGACGCGCCGATAC
CACAGCGAAGCGCTCAAGTTCATCAATGTCTTGCACGATGCCACTGCCATCATCTGCCAACTGCTGGGTTCGCGC
AATAAGAGCGAGGTGATTGAAGCAATGGACTATTTCGTCATTGGCGACGCATACAACGTCGAGCAGGTCAAAATT
GGCATCCGGCGCATGCTGCGGCTCATTTGGACCAAGGGCAACAGCGACGAGGGCAAGGGAGTGCAGACTCACTTG
ATAGAGTGCTACCGAAAGCTCTTCTTCGAAGCGCCCGAGTCGTTTAGTGAAAACGACACGGCCAACTACATTGCT
CGCAACATGATCAGCTTGACGTTTGGCGCCACGCCTGCGGAGCTGACCTCGCTGGAGCAGTTGCTCGCAACCATG
ATGAAGGCTGGCATCATGTCCGACTTGGTCGTCTCCAAGCTGTGGCAAGTGTATGGAGTGCAGAGACGCGAGATT
TCCAAGACTCAGCGAAGGGGCGCCATTATTGTGCTCGGCATGCTAGCCACGGCCAACCCCGAGATTGTTGTGGGC
GAAATCGAGACGATGCTCCAAACCGGCCTTGGAGTCCATGGCCACAACGACTTGCAGCTGGCAAAGTACACGTGC
ATTGCTCTTAGAAGGATCAATCCAACGGGTCGGCAAGCCAAGGAGCCTGGGCCAAAGTTTGCGCGCCTGGCCAAC
GACCACGCTGTGCCCGCAAGACTGGCAGCCATTACCCAAGTGTCGTCGGACAGCAATGAGTGGTACGGACTTGCG
GAGCAGGCCATTAATGCCATCTATGCCATTTCCAAGCACCCGGACACGCTCTGCTCCGATATCATCAAGCTCAAG
ACGCGGAGGATATTTGGCGGCTTGGAGCCGTCGTCAGGGCAATCGTCGCGCCCCACGTCACGCGATGAAACCAAG
ATGCTGAGCCAAGACAACCAGGAGATGATGAGCCGGGCGGTGGAACAACCAAGGACGCGGAACGACATCATTGGT
CTTTCCCAGCTCCTATTCATCGTTGGGCACGTTGCCATTAAGCAAATTGTGCATCTCGAGCTTTGCGAGCTTGAC
TTTAAGCGCAGAAAACAGGAAAAGGAAAAGCAAGCCAGCGCCAAGTCGGACAAGGAAAAGGAGGATGCTGATGAG
ATGGACCTCATTGGCGGGACGTCGGAAGACGACTTTACCGAAGCCATGGCTCACATTCGCGAGCGCGAGCTCTTG
TATGGCCCCAGCTCCTTGCTGGGGCTTTTTGGACCCTTGGTATCCGAGATTTGCGCCAACAACACCACCTATGCT
GAAGCGGGCTTGCAGGCCGCCGCGACGCTATGCCTGGCCAAGCTCATGTGTGTATCGGCCGAGTACTGCGAGACC
AACCTCCCCCTGCTCATCACAATCATGGAGCGGTCGCCCGACGCCACGGTGCGGTCCAATGCTGTGATTGCGCTG
GGCGACATGGCGGTCTGTTTCAACCATTTGATTGACGAAAACACCGACTTTTTGTATCGGCGCCTGGCGGATGAC
GACGCCTCGGTCAAGCGAACCTGCCTAATGACGCTCACCTTTCTCATCCTGGCGGGCCAGGTCAAGGTCAAGGGC
CAGCTAGGCGAGATGGCAAAGTGTCTCGAGGACAGCGATAGGCGGATAGCCGACTTGGCGCGCATGTTTTTTACG
GAGCTGAGCACCAAGGACAATGCAGTGTATAATCACTTTGTCGACATGTTTAGTCTGTTGAGTGCGGATGCCAAT
ATGGATGAGGATGTGTTTCGGCGCATTATCCGCTTCCTGCTGGGATTTGTTGAAAAGGTAATTATTTGGGGTTTT
TTTATAAGTTGCTTTCGACACTGGCCATGTCTATTTGACAAGAGACGCTTTGACTAATGACATATCAACAGGACA
AGCATGCAAAGCAACTGGCTGAAAAGTTGGCGGCGAGGTTGGCGCGGTGCGAGACGGAGAGGCAGTGGAACGACG
TGGCCTTTGCGCTGGGCCTGCTGCCGCACAAGAATGAAGAGATTGCAAAGACGGTGGCAGAGGGATTCAAGGTTG
TGGCTACGAGTGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail