Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5100
Gene name
LocationContig_453:7191..9586
Strand-
Gene length (bp)2395
Transcript length (bp)2340
Coding sequence length (bp)2340
Protein length (aa) 780

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03031 NIF NLI interacting factor-like phosphatase 1.4E-26 160 316
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 2.3E-07 535 596
PF12738 PTCB-BRCT twin BRCT domain 1.0E-05 538 591

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P376|FCP1_SCHPO RNA polymerase II subunit A C-terminal domain phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fcp1 PE=1 SV=1 6 667 8.0E-128
sp|Q03254|FCP1_YEAST RNA polymerase II subunit A C-terminal domain phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCP1 PE=1 SV=1 12 626 2.0E-106
sp|Q9Y5B0|CTDP1_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens GN=CTDP1 PE=1 SV=3 66 324 2.0E-45
sp|Q7TSG2|CTDP1_MOUSE RNA polymerase II subunit A C-terminal domain phosphatase OS=Mus musculus GN=Ctdp1 PE=1 SV=1 66 324 3.0E-45
sp|Q8SV03|FCP1_ENCCU RNA polymerase II subunit A C-terminal domain phosphatase OS=Encephalitozoon cuniculi (strain GB-M1) GN=FCP1 PE=1 SV=1 91 330 5.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P376|FCP1_SCHPO RNA polymerase II subunit A C-terminal domain phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fcp1 PE=1 SV=1 6 667 8.0E-128
sp|Q03254|FCP1_YEAST RNA polymerase II subunit A C-terminal domain phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCP1 PE=1 SV=1 12 626 2.0E-106
sp|Q9Y5B0|CTDP1_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens GN=CTDP1 PE=1 SV=3 66 324 2.0E-45
sp|Q7TSG2|CTDP1_MOUSE RNA polymerase II subunit A C-terminal domain phosphatase OS=Mus musculus GN=Ctdp1 PE=1 SV=1 66 324 3.0E-45
sp|Q8SV03|FCP1_ENCCU RNA polymerase II subunit A C-terminal domain phosphatase OS=Encephalitozoon cuniculi (strain GB-M1) GN=FCP1 PE=1 SV=1 91 330 5.0E-33
sp|Q00IB6|CPL4_ARATH RNA polymerase II C-terminal domain phosphatase-like 4 OS=Arabidopsis thaliana GN=CPL4 PE=1 SV=1 92 348 1.0E-23
sp|Q8LL04|CPL3_ARATH RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana GN=CPL3 PE=1 SV=2 150 346 1.0E-19
sp|Q7TSG2|CTDP1_MOUSE RNA polymerase II subunit A C-terminal domain phosphatase OS=Mus musculus GN=Ctdp1 PE=1 SV=1 500 631 1.0E-12
sp|Q9Y5B0|CTDP1_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens GN=CTDP1 PE=1 SV=3 500 609 3.0E-11
sp|Q8BG15|CTSL2_MOUSE CTD small phosphatase-like protein 2 OS=Mus musculus GN=Ctdspl2 PE=1 SV=1 158 266 4.0E-07
sp|Q5XIK8|CTSL2_RAT CTD small phosphatase-like protein 2 OS=Rattus norvegicus GN=Ctdspl2 PE=1 SV=1 158 266 4.0E-07
sp|Q05D32|CTSL2_HUMAN CTD small phosphatase-like protein 2 OS=Homo sapiens GN=CTDSPL2 PE=1 SV=2 158 266 5.0E-07
sp|A4QNX6|CTL2B_DANRE CTD small phosphatase-like protein 2-B OS=Danio rerio GN=ctdspl2b PE=2 SV=1 158 266 8.0E-07
sp|Q9N4V4|SCPL3_CAEEL CTD small phosphatase-like protein 3 OS=Caenorhabditis elegans GN=scpl-3 PE=3 SV=1 160 266 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5560
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5100 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2885
Ophiocordyceps camponoti-floridani Ophcf2|02629
Ophiocordyceps camponoti-rufipedis Ophun1|6996
Ophiocordyceps kimflemingae Ophio5|1372
Ophiocordyceps subramaniannii Hirsu2|7157

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5100
MHEKVVSLGSRLHYPITVTKLLKSPGDAIKKQEHILEYKFSWRRRVGDDDWADETTYTEFDSPAEGKLKEWRIQE
GMAISADLPCMVVEEACGHEVQIQGLCSLCGADMTEVNWASEEKDTDRAMINMTHDQTGLMVSQSVAQKAEHDTQ
RRLLRQRKLSLVVDLDQTIIHACIEPTIGEWQRDDTNPNYEAVKHVMSFQLNDDGPRGLASGCTYYIKLRPGLRD
FLSQVSKMYELHVYTMGTRAYALNIARIVDPDQKLFGNRVISRDENGSITAKSLQRLFPVSTNMVVIIDDRADVW
PGNRPNLIKVVPYDFFKGIGDINSSFLPKRTDLAPDSTLAAATTLLAQQKPPAGQTQAAASALDAPKDSPKLSPF
DELARMSSASDPLSLRMQAEEQEKTLEKQLTDRPLLHMQEELDRADEQSEENEDVEKQAHNHHRQHLLNDNDEEL
TSLQDHLTDLHAAFYEMYDQRRRERRKSEPKHQPGGTRVRRRSSVDDGVDLSMVPDVGDILDQLKSNVLSGLVIV
LSGLVPLGGQVEHTEIGMQALAFGAQMLNTLSRRVTHLVVSTSRPRTKKVQQAAKMPGIKIVNQNWLIDCLSQWR
RLDERPYFLEISSSDRDKPMDRDTSQNVTPDPEEDSEARDLKDFDWAKADEDLAEFLHDGQDDDSDDDLEEDDDL
DGDDDDQDGSDDDDDDQSSDEDITGSGNDSDTQDGEYVDQAGDNGKSDSSTESEGTQPKASKAARRTAKPRLPRS
SGYLALAGLAVCAPCGRQTRLAAAASAEE*
Coding >OphauG2|5100
ATGCACGAAAAAGTGGTGTCGTTGGGCTCCCGCCTCCACTATCCCATCACGGTTACAAAACTCCTCAAGTCGCCA
GGCGATGCCATCAAGAAACAAGAACACATCCTCGAGTACAAGTTTTCGTGGCGCCGCAGGGTCGGCGACGACGAT
TGGGCCGACGAGACCACCTACACAGAGTTTGACAGCCCGGCCGAGGGAAAGCTCAAGGAATGGCGCATCCAAGAG
GGCATGGCCATCAGCGCCGACCTGCCGTGCATGGTGGTGGAGGAGGCGTGTGGCCACGAGGTGCAGATCCAAGGC
CTGTGCAGCCTGTGCGGCGCCGACATGACAGAGGTCAACTGGGCCAGCGAGGAAAAGGACACAGACCGCGCCATG
ATCAACATGACGCATGACCAGACGGGCCTCATGGTGAGCCAAAGCGTCGCGCAAAAGGCTGAGCATGATACCCAG
CGCAGGCTTTTGCGGCAGCGCAAGTTGAGCCTCGTCGTCGATCTCGACCAGACCATTATCCACGCCTGTATCGAG
CCCACCATTGGCGAGTGGCAGCGCGATGATACAAACCCAAACTACGAGGCCGTCAAGCATGTCATGAGCTTCCAG
CTCAACGACGACGGCCCGCGAGGATTGGCTAGTGGCTGCACCTACTACATCAAGCTGCGGCCCGGGCTGCGCGAC
TTTCTCAGCCAAGTGTCCAAGATGTACGAGTTGCACGTCTACACAATGGGCACCAGAGCCTATGCCCTCAACATT
GCGCGCATAGTCGATCCCGACCAAAAGCTGTTTGGCAACCGTGTTATTAGCAGAGATGAAAACGGCAGCATTACC
GCCAAGAGCCTGCAACGTCTATTTCCTGTGAGCACAAACATGGTTGTCATTATTGATGATCGTGCCGACGTTTGG
CCAGGGAACCGCCCCAACCTCATCAAGGTTGTGCCCTATGATTTCTTCAAAGGCATTGGCGACATCAATTCGAGC
TTTTTGCCCAAGCGCACCGACTTGGCGCCAGACTCGACTCTAGCTGCCGCCACGACGCTTTTGGCCCAACAAAAA
CCACCCGCTGGCCAGACGCAGGCCGCTGCCTCGGCACTCGATGCGCCCAAGGACAGCCCCAAGCTATCGCCCTTT
GACGAGCTAGCACGCATGAGCAGTGCCTCGGACCCTTTGAGTCTGCGGATGCAGGCCGAAGAGCAGGAGAAGACG
CTGGAGAAGCAACTGACGGACCGGCCTCTGCTTCACATGCAAGAGGAACTCGACAGGGCCGACGAGCAGTCCGAG
GAAAATGAAGACGTGGAGAAGCAAGCACACAACCACCATCGGCAGCATCTGCTCAACGATAACGACGAGGAGCTT
ACTTCGCTCCAAGACCATCTGACGGATCTGCATGCTGCCTTTTACGAAATGTACGACCAGCGGCGGCGAGAAAGG
AGGAAATCAGAGCCAAAACACCAGCCTGGCGGCACCAGAGTGCGGCGACGGTCATCGGTTGACGACGGCGTTGAT
TTGTCCATGGTGCCCGATGTGGGAGACATTTTGGACCAGCTCAAGTCTAATGTGCTTTCGGGGCTCGTCATTGTG
CTCTCTGGCTTGGTTCCGCTTGGCGGACAGGTTGAACACACCGAGATTGGAATGCAGGCCTTGGCCTTTGGGGCC
CAAATGCTCAACACGCTGTCGCGACGCGTAACACATCTTGTCGTGTCGACATCGCGGCCGCGGACAAAAAAAGTG
CAGCAAGCAGCCAAAATGCCCGGCATCAAAATCGTCAATCAAAATTGGCTCATTGATTGCCTGAGCCAATGGCGG
CGGCTGGACGAGCGGCCATACTTTTTGGAGATATCCAGTAGCGACCGCGACAAGCCCATGGATCGTGACACGAGC
CAAAATGTCACGCCTGATCCCGAAGAAGACTCTGAGGCGCGCGATCTCAAAGACTTTGACTGGGCCAAGGCTGAC
GAAGACTTGGCCGAGTTTTTACACGACGGCCAAGACGACGACTCGGATGACGACTTGGAAGAAGATGATGACTTG
GATGGCGATGATGACGATCAAGATGGCTCCGACGACGACGACGACGACCAAAGCAGCGATGAGGACATTACTGGT
TCCGGCAACGACTCGGATACTCAAGACGGCGAATATGTTGATCAAGCCGGAGACAATGGCAAGAGCGACTCGAGC
ACAGAATCTGAAGGCACACAGCCCAAGGCCTCAAAGGCTGCAAGACGCACCGCCAAGCCGCGCTTGCCAAGAAGC
AGCGGCTATCTCGCACTCGCGGGGCTAGCAGTCTGCGCGCCATGCGGACGCCAGACGCGGCTGGCGGCGGCGGCC
TCTGCCGAGGAATAA
Transcript >OphauG2|5100
ATGCACGAAAAAGTGGTGTCGTTGGGCTCCCGCCTCCACTATCCCATCACGGTTACAAAACTCCTCAAGTCGCCA
GGCGATGCCATCAAGAAACAAGAACACATCCTCGAGTACAAGTTTTCGTGGCGCCGCAGGGTCGGCGACGACGAT
TGGGCCGACGAGACCACCTACACAGAGTTTGACAGCCCGGCCGAGGGAAAGCTCAAGGAATGGCGCATCCAAGAG
GGCATGGCCATCAGCGCCGACCTGCCGTGCATGGTGGTGGAGGAGGCGTGTGGCCACGAGGTGCAGATCCAAGGC
CTGTGCAGCCTGTGCGGCGCCGACATGACAGAGGTCAACTGGGCCAGCGAGGAAAAGGACACAGACCGCGCCATG
ATCAACATGACGCATGACCAGACGGGCCTCATGGTGAGCCAAAGCGTCGCGCAAAAGGCTGAGCATGATACCCAG
CGCAGGCTTTTGCGGCAGCGCAAGTTGAGCCTCGTCGTCGATCTCGACCAGACCATTATCCACGCCTGTATCGAG
CCCACCATTGGCGAGTGGCAGCGCGATGATACAAACCCAAACTACGAGGCCGTCAAGCATGTCATGAGCTTCCAG
CTCAACGACGACGGCCCGCGAGGATTGGCTAGTGGCTGCACCTACTACATCAAGCTGCGGCCCGGGCTGCGCGAC
TTTCTCAGCCAAGTGTCCAAGATGTACGAGTTGCACGTCTACACAATGGGCACCAGAGCCTATGCCCTCAACATT
GCGCGCATAGTCGATCCCGACCAAAAGCTGTTTGGCAACCGTGTTATTAGCAGAGATGAAAACGGCAGCATTACC
GCCAAGAGCCTGCAACGTCTATTTCCTGTGAGCACAAACATGGTTGTCATTATTGATGATCGTGCCGACGTTTGG
CCAGGGAACCGCCCCAACCTCATCAAGGTTGTGCCCTATGATTTCTTCAAAGGCATTGGCGACATCAATTCGAGC
TTTTTGCCCAAGCGCACCGACTTGGCGCCAGACTCGACTCTAGCTGCCGCCACGACGCTTTTGGCCCAACAAAAA
CCACCCGCTGGCCAGACGCAGGCCGCTGCCTCGGCACTCGATGCGCCCAAGGACAGCCCCAAGCTATCGCCCTTT
GACGAGCTAGCACGCATGAGCAGTGCCTCGGACCCTTTGAGTCTGCGGATGCAGGCCGAAGAGCAGGAGAAGACG
CTGGAGAAGCAACTGACGGACCGGCCTCTGCTTCACATGCAAGAGGAACTCGACAGGGCCGACGAGCAGTCCGAG
GAAAATGAAGACGTGGAGAAGCAAGCACACAACCACCATCGGCAGCATCTGCTCAACGATAACGACGAGGAGCTT
ACTTCGCTCCAAGACCATCTGACGGATCTGCATGCTGCCTTTTACGAAATGTACGACCAGCGGCGGCGAGAAAGG
AGGAAATCAGAGCCAAAACACCAGCCTGGCGGCACCAGAGTGCGGCGACGGTCATCGGTTGACGACGGCGTTGAT
TTGTCCATGGTGCCCGATGTGGGAGACATTTTGGACCAGCTCAAGTCTAATGTGCTTTCGGGGCTCGTCATTGTG
CTCTCTGGCTTGGTTCCGCTTGGCGGACAGGTTGAACACACCGAGATTGGAATGCAGGCCTTGGCCTTTGGGGCC
CAAATGCTCAACACGCTGTCGCGACGCGTAACACATCTTGTCGTGTCGACATCGCGGCCGCGGACAAAAAAAGTG
CAGCAAGCAGCCAAAATGCCCGGCATCAAAATCGTCAATCAAAATTGGCTCATTGATTGCCTGAGCCAATGGCGG
CGGCTGGACGAGCGGCCATACTTTTTGGAGATATCCAGTAGCGACCGCGACAAGCCCATGGATCGTGACACGAGC
CAAAATGTCACGCCTGATCCCGAAGAAGACTCTGAGGCGCGCGATCTCAAAGACTTTGACTGGGCCAAGGCTGAC
GAAGACTTGGCCGAGTTTTTACACGACGGCCAAGACGACGACTCGGATGACGACTTGGAAGAAGATGATGACTTG
GATGGCGATGATGACGATCAAGATGGCTCCGACGACGACGACGACGACCAAAGCAGCGATGAGGACATTACTGGT
TCCGGCAACGACTCGGATACTCAAGACGGCGAATATGTTGATCAAGCCGGAGACAATGGCAAGAGCGACTCGAGC
ACAGAATCTGAAGGCACACAGCCCAAGGCCTCAAAGGCTGCAAGACGCACCGCCAAGCCGCGCTTGCCAAGAAGC
AGCGGCTATCTCGCACTCGCGGGGCTAGCAGTCTGCGCGCCATGCGGACGCCAGACGCGGCTGGCGGCGGCGGCC
TCTGCCGAGGAATAA
Gene >OphauG2|5100
ATGCACGAAAAAGTGGTGTCGTTGGGCTCCCGCCTCCACTATCCCATCACGGTTACAAAACTCCTCAAGTCGCCA
GGCGATGCCATCAAGAAACAAGAACACATCCTCGAGTACAAGTTTTCGTGGCGCCGCAGGGTCGGCGACGACGAT
TGGGCCGACGAGACCACCTACACAGAGTTTGACAGCCCGGCCGAGGGAAAGCTCAAGGAATGGCGCATCCAAGAG
GGCATGGCCATCAGCGCCGACCTGCCGTGCATGGTGGTGGAGGAGGCGTGTGGCCACGAGGTGCAGATCCAAGGC
CTGTGCAGCCTGTGCGGCGCCGACATGACAGAGGTCAACTGGGCCAGCGAGGAAAAGGACACAGACCGCGCCATG
ATCAACATGACGCATGACCAGACGGGCCTCATGGTGAGCCAAAGCGTCGCGCAAAAGGCTGAGCATGATACCCAG
CGCAGGCTTTTGCGGCAGCGCAAGTTGAGCCTCGTCGTCGATCTCGACCAGACCATTATCCACGCCTGTATCGAG
CCCACCATTGGCGAGTGGCAGCGCGATGATACAAACCCAAACTACGAGGCCGTCAAGCATGTCATGAGCTTCCAG
CTCAACGACGACGGCCCGCGAGGATTGGCTAGTGGCTGCACCTACTACATCAAGCTGCGGCCCGGGCTGCGCGAC
TTTCTCAGCCAAGTGTCCAAGATGTACGAGTTGCACGTCTACACAATGGGCACCAGAGCCTATGCCCTCAACATT
GCGCGCATAGTCGATCCCGACCAAAAGCTGTTTGGCAACCGTGTTATTAGCAGAGATGAAAACGGCAGCATTACC
GCCAAGAGCCTGCAACGTCTATTTCCTGTGAGCACAAACATGGTTGTCATTATTGATGATCGTGCCGACGTTTGG
CCAGGGAACCGCCCCAACCTCATCAAGGTTGTGCCCTATGATTTCTTCAAAGGCATTGGCGACATCAATTCGAGC
TTTTTGCCCAAGCGCACCGACTTGGCGCCAGACTCGACTCTAGCTGCCGCCACGACGCTTTTGGCCCAACAAAAA
CCACCCGCTGGCCAGACGCAGGCCGCTGCCTCGGCACTCGATGCGCCCAAGGACAGCCCCAAGCTATCGCCCTTT
GACGAGCTAGCACGCATGAGCAGTGCCTCGGACCCTTTGAGTCTGCGGATGCAGGCCGAAGAGCAGGAGAAGACG
CTGGAGAAGCAACTGACGGACCGGCCTCTGCTTCACATGCAAGAGGAACTCGACAGGGCCGACGAGCAGTCCGAG
GAAAATGAAGACGTGGAGAAGCAAGCACACAACCACCATCGGCAGCATCTGCTCAACGATAACGACGAGGAGCTT
ACTTCGCTCCAAGACCATCTGACGGATCTGCATGCTGCCTTTTACGAAATGTACGACCAGCGGCGGCGAGAAAGG
AGGAAATCAGAGCCAAAACACCAGCCTGGCGGCACCAGAGTGCGGCGACGGTCATCGGTTGACGACGGCGTTGAT
TTGTCCATGGTGCCCGATGTGGGAGACATTTTGGACCAGCTCAAGTCTAATGTGCTTTCGGGGCTCGTCATTGTG
CTCTCTGGCTTGGTTCCGCTTGGCGGACAGGTTGAACACACCGAGATTGGAATGCAGGCCTTGGCCTTTGGGGCC
CAAATGCTCAACACGCTGTCGCGACGCGTAACACATCTTGTCGTGTCGACATCGCGGCCGCGGACAAAAAAAGTG
CAGCAAGCAGCCAAAATGCCCGGCATCAAAATCGTCAATCAAAATTGGCTCATTGATTGCCTGAGCCAATGGCGG
CGGCTGGACGAGCGGCCATACTTTTTGGAGATATCCAGTAGCGACCGCGACAAGCCCATGGATCGTGACACGAGC
CAAAATGTCACGCCTGATCCCGAAGAAGACTCTGAGGCGCGCGATCTCAAAGACTTTGACTGGGCCAAGGCTGAC
GAAGACTTGGCCGAGTTTTTACACGACGGCCAAGACGACGACTCGGATGACGACTTGGAAGAAGATGATGACTTG
GATGGCGATGATGACGATCAAGATGGCTCCGACGACGACGACGACGACCAAAGCAGCGATGAGGACATTACTGGT
TCCGGCAACGACTCGGATACTCAAGACGGCGAATATGTTGATCAAGCCGGAGACAATGGCAAGAGCGACTCGAGC
ACAGAATCTGAAGGCACACAGCCCAAGGCCTCAAAGGCTGCAAGACGCACCGCCAAGCGTAAGAAGCTCGCAGAC
GGAGAGGAATCTGACGCCGACGCTTCTTTGAGCGGCAGCGCGCTTGCCAAGAAGCAGCGGCTATCTCGCACTCGC
GGGGCTAGCAGTCTGCGCGCCATGCGGACGCCAGACGCGGCTGGCGGCGGCGGCCTCTGCCGAGGAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail