Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5096
Gene name
LocationContig_452:9457..10876
Strand-
Gene length (bp)1419
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10282 Lactonase Lactonase, 7-bladed beta-propeller 7.3E-72 59 401

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B0N9|6PGL_ARTBC Probable 6-phosphogluconolactonase ARB_02015 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02015 PE=1 SV=1 6 388 6.0E-25
sp|A4TNQ8|6PGL_YERPP 6-phosphogluconolactonase OS=Yersinia pestis (strain Pestoides F) GN=pgl PE=3 SV=1 169 394 7.0E-15
sp|Q1CFQ1|6PGL_YERPN 6-phosphogluconolactonase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pgl PE=3 SV=1 169 394 7.0E-15
sp|Q8ZGX4|6PGL_YERPE 6-phosphogluconolactonase OS=Yersinia pestis GN=pgl PE=3 SV=1 169 394 7.0E-15
sp|Q1C949|6PGL_YERPA 6-phosphogluconolactonase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pgl PE=3 SV=1 169 394 7.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B0N9|6PGL_ARTBC Probable 6-phosphogluconolactonase ARB_02015 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02015 PE=1 SV=1 6 388 6.0E-25
sp|A4TNQ8|6PGL_YERPP 6-phosphogluconolactonase OS=Yersinia pestis (strain Pestoides F) GN=pgl PE=3 SV=1 169 394 7.0E-15
sp|Q1CFQ1|6PGL_YERPN 6-phosphogluconolactonase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pgl PE=3 SV=1 169 394 7.0E-15
sp|Q8ZGX4|6PGL_YERPE 6-phosphogluconolactonase OS=Yersinia pestis GN=pgl PE=3 SV=1 169 394 7.0E-15
sp|Q1C949|6PGL_YERPA 6-phosphogluconolactonase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pgl PE=3 SV=1 169 394 7.0E-15
sp|A7FKN1|6PGL_YERP3 6-phosphogluconolactonase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pgl PE=3 SV=1 169 394 7.0E-15
sp|B1JSS6|6PGL_YERPY 6-phosphogluconolactonase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pgl PE=3 SV=1 169 394 1.0E-14
sp|Q66D69|6PGL_YERPS 6-phosphogluconolactonase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pgl PE=3 SV=1 169 394 1.0E-14
sp|B2K8S8|6PGL_YERPB 6-phosphogluconolactonase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pgl PE=3 SV=1 169 394 1.0E-14
sp|A1JS71|6PGL_YERE8 6-phosphogluconolactonase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pgl PE=3 SV=1 170 394 3.0E-14
sp|A8GBC1|6PGL_SERP5 6-phosphogluconolactonase OS=Serratia proteamaculans (strain 568) GN=pgl PE=3 SV=1 180 394 4.0E-14
sp|Q49YW6|Y869_STAS1 Uncharacterized protein SSP0869 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0869 PE=3 SV=1 131 388 9.0E-13
sp|Q6GFD5|Y2014_STAAR Uncharacterized protein SAR2014 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2014 PE=3 SV=1 117 406 2.0E-12
sp|Q8NVS2|Y1862_STAAW Uncharacterized protein MW1862 OS=Staphylococcus aureus (strain MW2) GN=MW1862 PE=3 SV=1 117 406 2.0E-12
sp|Q2FFH4|Y1902_STAA3 Uncharacterized protein SAUSA300_1902 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1902 PE=3 SV=1 117 406 2.0E-12
sp|Q5HEJ8|Y1985_STAAC Uncharacterized protein SACOL1985 OS=Staphylococcus aureus (strain COL) GN=SACOL1985 PE=3 SV=1 117 406 2.0E-12
sp|Q2FWX8|Y2143_STAA8 Uncharacterized protein SAOUHSC_02143 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02143 PE=3 SV=1 117 406 2.0E-12
sp|Q6G811|Y1845_STAAS Uncharacterized protein SAS1845 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1845 PE=3 SV=1 117 406 2.0E-12
sp|O59681|YBS1_SCHPO Uncharacterized protein C18E5.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18E5.01 PE=3 SV=1 71 385 4.0E-12
sp|Q99SW6|Y1921_STAAM Uncharacterized protein SAV1921 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1921 PE=3 SV=1 117 406 5.0E-12
sp|Q7A4P4|Y1737_STAAN Uncharacterized protein SA1737 OS=Staphylococcus aureus (strain N315) GN=SA1737 PE=1 SV=1 117 406 5.0E-12
sp|Q2NUK0|6PGL_SODGM 6-phosphogluconolactonase OS=Sodalis glossinidius (strain morsitans) GN=pgl PE=3 SV=1 181 395 6.0E-12
sp|O34499|6PGL_BACSU 6-phosphogluconolactonase OS=Bacillus subtilis (strain 168) GN=pgl PE=1 SV=1 72 388 1.0E-11
sp|Q2YU76|Y1858_STAAB Uncharacterized protein SAB1858c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1858c PE=3 SV=1 118 406 1.0E-11
sp|C6DCH7|6PGL_PECCP 6-phosphogluconolactonase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pgl PE=3 SV=1 181 395 2.0E-10
sp|Q6D7C2|6PGL_PECAS 6-phosphogluconolactonase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pgl PE=3 SV=1 181 395 2.0E-09
sp|O86271|YWCC_LACLA Uncharacterized protein YwcC OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ywcC PE=3 SV=1 72 388 3.0E-09
sp|B2VBU3|6PGL_ERWT9 6-phosphogluconolactonase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pgl PE=3 SV=1 181 405 5.0E-08
sp|A7MIZ2|6PGL_CROS8 6-phosphogluconolactonase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pgl PE=3 SV=1 181 405 7.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5096
MAARLVKTWAMLTLLLGGVDGQQQVATLVYVSSYSGNMTTLALEAMTSSARGISGGMVQLQPVDVTDGCGASPSF
LTLDAQRRIVFCVNEDLDGGRGSLGILETRCGGRLTPRTQVESGAGPVFSALFEHGRGLAVANYAASSISTFDVS
SPCQPSLVATQAFALDKPGPVPDRQSAPRPHQAIVDPTGRFLAVPDLGADVVRLFHLGKDLRPRPAGHVAVKPGS
GPRHAAFVHLGHATFMYLVNELSNTIDGFRVTYSGHDAIHMEPIFTMGTHGGKEGVESNHVFASEIVISPDKRFV
IVSSRNESALSIPNFDASDPPPLVSDPLINFRIDPQSGALHLLQDNVPAGGRFPRHFSLNRDGSLLAVGLQLDSR
VAFIQRDAASGEIGNFVAYADVAGQVTSVIFDD*
Coding >OphauG2|5096
ATGGCGGCCCGACTCGTCAAGACGTGGGCCATGTTGACTCTGCTCTTGGGCGGCGTTGACGGCCAGCAGCAAGTG
GCGACGCTTGTCTACGTGTCGTCGTACAGCGGCAACATGACGACGCTGGCACTGGAAGCCATGACCAGCAGCGCC
AGGGGCATCTCGGGCGGCATGGTCCAGCTGCAGCCCGTCGACGTAACAGATGGGTGCGGCGCGAGCCCGTCCTTT
TTGACGCTGGATGCGCAGCGCCGCATCGTGTTTTGCGTCAACGAAGACCTTGACGGCGGCAGGGGCTCGCTGGGC
ATCTTGGAGACGAGGTGTGGCGGCCGGTTGACGCCTCGGACGCAGGTCGAGTCGGGCGCAGGGCCCGTCTTTTCG
GCGCTGTTTGAACACGGTCGAGGGCTCGCCGTGGCCAACTATGCAGCCTCGTCCATTTCCACCTTTGACGTCTCG
TCGCCCTGCCAGCCCAGCCTCGTGGCCACCCAGGCCTTTGCTCTCGACAAGCCCGGCCCTGTTCCCGACCGCCAG
TCGGCCCCGCGCCCGCACCAGGCCATTGTCGACCCCACCGGCCGCTTCCTGGCCGTGCCGGACCTGGGCGCCGAC
GTGGTGCGCCTCTTCCATCTCGGCAAGGACCTGCGGCCGCGGCCAGCGGGCCACGTCGCCGTCAAGCCGGGCAGT
GGACCGCGCCACGCTGCCTTTGTCCACCTTGGCCATGCCACCTTTATGTATCTCGTCAATGAGCTGTCCAACACC
ATTGACGGCTTTCGCGTCACTTACAGTGGCCACGACGCTATCCACATGGAGCCCATTTTCACCATGGGCACCCAT
GGCGGAAAGGAGGGCGTCGAGTCCAACCATGTCTTTGCCTCGGAGATTGTGATTTCGCCCGACAAGCGCTTCGTC
ATCGTCTCCTCCCGCAACGAAAGCGCCCTCTCCATTCCAAACTTTGACGCCTCAGACCCACCCCCCCTCGTCTCG
GACCCCCTCATCAACTTCCGCATCGACCCTCAGTCCGGCGCCCTTCATCTCCTTCAGGATAACGTCCCCGCCGGC
GGCCGCTTCCCCCGCCACTTTTCTCTCAACCGCGACGGCTCCCTGCTCGCTGTCGGTCTGCAGCTCGACTCCCGC
GTCGCCTTTATCCAGCGCGATGCTGCGTCGGGCGAGATTGGCAACTTTGTCGCCTACGCCGACGTTGCTGGGCAA
GTCACCTCGGTCATTTTTGACGACTAA
Transcript >OphauG2|5096
ATGGCGGCCCGACTCGTCAAGACGTGGGCCATGTTGACTCTGCTCTTGGGCGGCGTTGACGGCCAGCAGCAAGTG
GCGACGCTTGTCTACGTGTCGTCGTACAGCGGCAACATGACGACGCTGGCACTGGAAGCCATGACCAGCAGCGCC
AGGGGCATCTCGGGCGGCATGGTCCAGCTGCAGCCCGTCGACGTAACAGATGGGTGCGGCGCGAGCCCGTCCTTT
TTGACGCTGGATGCGCAGCGCCGCATCGTGTTTTGCGTCAACGAAGACCTTGACGGCGGCAGGGGCTCGCTGGGC
ATCTTGGAGACGAGGTGTGGCGGCCGGTTGACGCCTCGGACGCAGGTCGAGTCGGGCGCAGGGCCCGTCTTTTCG
GCGCTGTTTGAACACGGTCGAGGGCTCGCCGTGGCCAACTATGCAGCCTCGTCCATTTCCACCTTTGACGTCTCG
TCGCCCTGCCAGCCCAGCCTCGTGGCCACCCAGGCCTTTGCTCTCGACAAGCCCGGCCCTGTTCCCGACCGCCAG
TCGGCCCCGCGCCCGCACCAGGCCATTGTCGACCCCACCGGCCGCTTCCTGGCCGTGCCGGACCTGGGCGCCGAC
GTGGTGCGCCTCTTCCATCTCGGCAAGGACCTGCGGCCGCGGCCAGCGGGCCACGTCGCCGTCAAGCCGGGCAGT
GGACCGCGCCACGCTGCCTTTGTCCACCTTGGCCATGCCACCTTTATGTATCTCGTCAATGAGCTGTCCAACACC
ATTGACGGCTTTCGCGTCACTTACAGTGGCCACGACGCTATCCACATGGAGCCCATTTTCACCATGGGCACCCAT
GGCGGAAAGGAGGGCGTCGAGTCCAACCATGTCTTTGCCTCGGAGATTGTGATTTCGCCCGACAAGCGCTTCGTC
ATCGTCTCCTCCCGCAACGAAAGCGCCCTCTCCATTCCAAACTTTGACGCCTCAGACCCACCCCCCCTCGTCTCG
GACCCCCTCATCAACTTCCGCATCGACCCTCAGTCCGGCGCCCTTCATCTCCTTCAGGATAACGTCCCCGCCGGC
GGCCGCTTCCCCCGCCACTTTTCTCTCAACCGCGACGGCTCCCTGCTCGCTGTCGGTCTGCAGCTCGACTCCCGC
GTCGCCTTTATCCAGCGCGATGCTGCGTCGGGCGAGATTGGCAACTTTGTCGCCTACGCCGACGTTGCTGGGCAA
GTCACCTCGGTCATTTTTGACGACTAA
Gene >OphauG2|5096
ATGGCGGCCCGACTCGTCAAGACGTGGGCCATGTTGACTCTGCTCTTGGGCGGCGTTGACGGCCAGCAGCAAGTG
GCGACGCTTGTCTACGTGTCGTCGTACAGCGGCAACATGACGACGCTGGCACTGGAAGCCATGACCAGCAGCGCC
AGGGGCATCTCGGGCGGCATGGTCCAGCTGCAGCCCGTCGACGTAACAGATGGGTGCGGCGCGAGCCCGTCCTTT
TTGACGCTGGATGCGCAGCGCCGCATCGTGTTTTGCGTCAACGAAGACCTTGACGGCGGCAGGGGCTCGCTGGGC
ATCTTGGAGACGAGGTGTGGCGGCCGGTTGACGCCTCGGACGCAGGTCGAGTCGGGCGCAGGGCCCGTCTTTTCG
GCGCTGTTTGAACACGGTCGAGGGCTCGCCGTGGCCAACTAGTAAGCCTGTTGTTGGTCGGCCTGCGGCTCGAGA
CTAACTCGTCGCCTCCTTGCCACAGTGCAGCCTCGTCCATTTCCACCTTTGACGTCTCGTCGCCCTGCCAGCCCA
GCCTCGTGGCCACCCAGGCCTTTGCTCTCGACAAGCCCGGCCCTGTTCCCGACCGCCAGTCGGCCCCGCGCCCGC
ACCAGGCCATTGTCGACCCCACCGGCCGCTTCCTGGCCGTGCCGGACCTGGGCGCCGACGTGGTGCGCCTCTTCC
ATCTCGGCAAGGACCTGCGGCCGCGGCCAGCGGGCCACGTCGCCGTCAAGCCGGGCAGTGGACCGCGCCACGCTG
CCTTTGTCCACCTTGGCCATGCCACCTTTATGTATCTCGTCAATGAGCTGTCCAACACCATTGACGGCTTTCGCG
TCACTTACAGTGGCCACGACGCTATCCACATGGAGCCCATTTTCACCATGGGCACCCATGGCGGAAAGGAGGGCG
TCGAGTCCAACCATGTCTTTGCCTCGGAGATTGTGATTTCGGTACATCTCTCATGTCTCAGCTATTCTTTCTTGT
TCCTCTCGCTTCTTCTCCTTGTTCCTCTCGCTTCCTCTGAGAGCCCTGTTTCACCCCGTGTCTCAATTTTTTTTT
TCTCGCGCTCACCATGCTCCCCAGCCCGACAAGCGCTTCGTCATCGTCTCCTCCCGCAACGAAAGCGCCCTCTCC
ATTCCAAACTTTGACGCCTCAGACCCACCCCCCCTCGTCTCGGACCCCCTCATCAACTTCCGCATCGACCCTCAG
TCCGGCGCCCTTCATCTCCTTCAGGATAACGTCCCCGCCGGCGGCCGCTTCCCCCGCCACTTTTCTCTCAACCGC
GACGGCTCCCTGCTCGCTGTCGGTCTGCAGCTCGACTCCCGCGTCGCCTTTATCCAGCGCGATGCTGCGTCGGGC
GAGATTGGCAACTTTGTCGCCTACGCCGACGTTGCTGGGCAAGTCACCTCGGTCATTTTTGACGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail