Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5094
Gene name
LocationContig_452:682..3114
Strand-
Gene length (bp)2432
Transcript length (bp)2373
Coding sequence length (bp)2373
Protein length (aa) 791

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 321 408 3.0E-08
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 313 403 2.0E-07
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 321 473 3.0E-07
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 322 475 3.0E-07
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 318 403 7.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5094
MRFSALCLASALELCAASTFVARHPAASRSLYPVANTSRPLDSSTSFTSSPTLDAAALLLPSSAATNGSTSALSW
VPATSTPSTSFNQTANAQRHVAPTPASSSPSSSSDFATRANLTLTTPPQPLITPAPSQGLFLTVTVDCANSWNRT
ECRFAPSGNMTRIFRPMPPKTINADECTTMSDPERAATSISVVYTSTVTVWGNRSAYTPPYEPMILPNYCPTESF
EPIDWNALLASDFYSKVMIHESYDHAMDRFTIPQPRMAFTFITTAKNPSVVYSEEPAPEYSPSWNSPGDKDGGAH
KPALQEGENARAPPANKGNHKPMADSKHVDGSRPVDNGEPSSSNAKPGNNAKPVAKPKPVGNSNPVDNSKPVDRP
SPVGNSKPVDRSRPVDSSKLIDNSKPADKPKAAPPDAAGQPLNQGKQDVGLVGPPGSHLNGGFGAAPDTDRHGVV
APPRPSFTIAARASQVAINGQTISDLGFGQTSVVNVQGSAFTIFPSSVVGQGSTLRKPAPGPTGVWISTPTAALV
GGLPVTVRGRKAVIAGSTMDIPETATSTVIQGQPVALGPGSLVVGHESLAFQAVFPWRETHVMVKDAQLITASGR
SVVVVHSTTYTYGLGIPATALVVGSDTVSIGPSGVSVHGRRLGGQTAGVGAMDFEAIGGNAITEIGPSLAVIDHT
TLTVGPGSPQTTRVIAGSTYTLGPGGITASGWTLAYPFGQEIVTTFYPARSRQAALAVETAPAMDLGTPDGGQQG
GASGGHGRAQGKKGSIKKGAAASLKAPVAFCIAMGVVCLF*
Coding >OphauG2|5094
ATGAGGTTCTCAGCCCTGTGCCTTGCCAGCGCTCTCGAGCTATGCGCTGCCTCGACCTTTGTAGCACGCCACCCA
GCCGCCAGCAGGTCTTTGTATCCTGTGGCCAACACCAGCCGCCCTCTCGACTCCTCCACCTCTTTTACTTCCTCT
CCTACTCTGGACGCTGCCGCCCTACTCTTGCCCTCTTCTGCCGCCACCAATGGCTCCACAAGCGCCTTGTCGTGG
GTTCCGGCAACATCGACGCCCTCAACCTCGTTTAACCAGACAGCCAACGCCCAAAGACATGTCGCTCCCACACCT
GCATCATCATCGCCATCATCATCATCAGACTTTGCCACACGGGCCAACCTGACCTTGACTACCCCCCCTCAGCCT
CTGATTACGCCAGCGCCATCCCAGGGACTCTTTTTGACGGTGACGGTCGACTGCGCAAATTCCTGGAACCGTACA
GAGTGTCGCTTTGCGCCCTCGGGCAACATGACGAGAATCTTCCGGCCTATGCCGCCCAAAACAATCAATGCGGAC
GAGTGTACCACCATGTCGGACCCTGAAAGGGCCGCGACCAGTATCTCCGTCGTGTACACGTCAACCGTGACGGTA
TGGGGAAATAGAAGCGCCTATACGCCGCCATATGAGCCCATGATTTTGCCCAACTATTGTCCTACGGAAAGCTTT
GAACCAATCGATTGGAACGCCTTGCTGGCGTCTGATTTCTATTCCAAAGTCATGATTCATGAGTCGTATGACCAC
GCTATGGATAGATTTACAATACCGCAGCCCCGCATGGCCTTTACTTTTATCACGACAGCCAAGAACCCTTCGGTC
GTTTACTCGGAAGAGCCTGCTCCCGAGTACAGTCCGTCGTGGAATTCGCCCGGCGACAAGGATGGTGGCGCCCAC
AAGCCAGCGCTTCAAGAGGGCGAGAATGCCAGAGCGCCACCTGCCAATAAAGGCAATCACAAACCCATGGCCGAT
TCCAAGCATGTAGATGGATCAAGGCCAGTCGACAATGGCGAGCCTAGTAGCAGCAATGCCAAGCCAGGTAACAAT
GCCAAGCCAGTCGCGAAGCCCAAGCCAGTTGGCAATTCCAATCCAGTCGACAATTCCAAGCCAGTCGACAGACCA
AGCCCAGTCGGCAATTCCAAACCAGTCGACAGATCAAGACCAGTCGACAGTTCAAAGCTCATTGACAATTCCAAG
CCCGCCGACAAGCCCAAGGCAGCACCACCCGACGCGGCGGGACAGCCTTTGAATCAAGGGAAACAAGATGTCGGA
TTAGTCGGTCCGCCTGGCTCGCATCTCAACGGCGGCTTTGGTGCTGCGCCTGACACAGACAGACACGGAGTCGTG
GCCCCTCCACGACCAAGCTTCACCATTGCCGCTCGCGCCTCACAAGTGGCGATTAATGGACAGACGATTTCAGAT
TTGGGCTTTGGGCAGACATCGGTAGTAAATGTGCAAGGAAGCGCCTTTACCATTTTCCCGAGCTCAGTTGTCGGG
CAGGGGAGCACGTTGAGGAAGCCTGCACCAGGCCCAACGGGCGTATGGATTTCGACGCCAACAGCTGCCCTTGTT
GGCGGGCTCCCTGTCACGGTCAGGGGCCGCAAGGCCGTTATTGCCGGCTCCACCATGGATATACCCGAGACAGCC
ACAAGCACCGTGATTCAGGGCCAGCCCGTCGCTCTTGGGCCGGGGTCTCTTGTCGTGGGCCACGAGTCGCTGGCC
TTCCAAGCCGTGTTTCCATGGCGAGAAACGCACGTCATGGTCAAGGACGCGCAGCTCATTACAGCCAGTGGGCGC
AGTGTCGTTGTGGTGCACTCGACCACGTATACCTATGGGCTTGGGATCCCGGCCACGGCGCTGGTTGTTGGAAGC
GACACGGTGTCGATTGGCCCGTCGGGAGTGTCGGTCCATGGCCGGCGGCTGGGCGGACAAACGGCGGGCGTTGGA
GCCATGGACTTTGAGGCCATTGGCGGCAATGCCATTACTGAGATTGGGCCCAGCCTGGCCGTCATTGACCATACA
ACGCTGACGGTTGGGCCCGGAAGCCCCCAGACGACCAGAGTCATTGCCGGCAGCACGTATACCCTCGGCCCGGGA
GGCATCACAGCCTCGGGCTGGACCTTGGCCTATCCGTTTGGCCAGGAAATCGTCACCACGTTTTACCCAGCCCGC
TCAAGACAGGCGGCGCTGGCAGTGGAGACGGCGCCGGCCATGGACCTGGGCACCCCCGACGGCGGCCAACAAGGC
GGCGCCAGTGGTGGACACGGGCGTGCCCAGGGCAAGAAGGGTAGCATAAAAAAGGGGGCAGCCGCGTCGCTCAAG
GCGCCAGTAGCTTTTTGCATAGCAATGGGAGTTGTCTGCCTTTTTTAG
Transcript >OphauG2|5094
ATGAGGTTCTCAGCCCTGTGCCTTGCCAGCGCTCTCGAGCTATGCGCTGCCTCGACCTTTGTAGCACGCCACCCA
GCCGCCAGCAGGTCTTTGTATCCTGTGGCCAACACCAGCCGCCCTCTCGACTCCTCCACCTCTTTTACTTCCTCT
CCTACTCTGGACGCTGCCGCCCTACTCTTGCCCTCTTCTGCCGCCACCAATGGCTCCACAAGCGCCTTGTCGTGG
GTTCCGGCAACATCGACGCCCTCAACCTCGTTTAACCAGACAGCCAACGCCCAAAGACATGTCGCTCCCACACCT
GCATCATCATCGCCATCATCATCATCAGACTTTGCCACACGGGCCAACCTGACCTTGACTACCCCCCCTCAGCCT
CTGATTACGCCAGCGCCATCCCAGGGACTCTTTTTGACGGTGACGGTCGACTGCGCAAATTCCTGGAACCGTACA
GAGTGTCGCTTTGCGCCCTCGGGCAACATGACGAGAATCTTCCGGCCTATGCCGCCCAAAACAATCAATGCGGAC
GAGTGTACCACCATGTCGGACCCTGAAAGGGCCGCGACCAGTATCTCCGTCGTGTACACGTCAACCGTGACGGTA
TGGGGAAATAGAAGCGCCTATACGCCGCCATATGAGCCCATGATTTTGCCCAACTATTGTCCTACGGAAAGCTTT
GAACCAATCGATTGGAACGCCTTGCTGGCGTCTGATTTCTATTCCAAAGTCATGATTCATGAGTCGTATGACCAC
GCTATGGATAGATTTACAATACCGCAGCCCCGCATGGCCTTTACTTTTATCACGACAGCCAAGAACCCTTCGGTC
GTTTACTCGGAAGAGCCTGCTCCCGAGTACAGTCCGTCGTGGAATTCGCCCGGCGACAAGGATGGTGGCGCCCAC
AAGCCAGCGCTTCAAGAGGGCGAGAATGCCAGAGCGCCACCTGCCAATAAAGGCAATCACAAACCCATGGCCGAT
TCCAAGCATGTAGATGGATCAAGGCCAGTCGACAATGGCGAGCCTAGTAGCAGCAATGCCAAGCCAGGTAACAAT
GCCAAGCCAGTCGCGAAGCCCAAGCCAGTTGGCAATTCCAATCCAGTCGACAATTCCAAGCCAGTCGACAGACCA
AGCCCAGTCGGCAATTCCAAACCAGTCGACAGATCAAGACCAGTCGACAGTTCAAAGCTCATTGACAATTCCAAG
CCCGCCGACAAGCCCAAGGCAGCACCACCCGACGCGGCGGGACAGCCTTTGAATCAAGGGAAACAAGATGTCGGA
TTAGTCGGTCCGCCTGGCTCGCATCTCAACGGCGGCTTTGGTGCTGCGCCTGACACAGACAGACACGGAGTCGTG
GCCCCTCCACGACCAAGCTTCACCATTGCCGCTCGCGCCTCACAAGTGGCGATTAATGGACAGACGATTTCAGAT
TTGGGCTTTGGGCAGACATCGGTAGTAAATGTGCAAGGAAGCGCCTTTACCATTTTCCCGAGCTCAGTTGTCGGG
CAGGGGAGCACGTTGAGGAAGCCTGCACCAGGCCCAACGGGCGTATGGATTTCGACGCCAACAGCTGCCCTTGTT
GGCGGGCTCCCTGTCACGGTCAGGGGCCGCAAGGCCGTTATTGCCGGCTCCACCATGGATATACCCGAGACAGCC
ACAAGCACCGTGATTCAGGGCCAGCCCGTCGCTCTTGGGCCGGGGTCTCTTGTCGTGGGCCACGAGTCGCTGGCC
TTCCAAGCCGTGTTTCCATGGCGAGAAACGCACGTCATGGTCAAGGACGCGCAGCTCATTACAGCCAGTGGGCGC
AGTGTCGTTGTGGTGCACTCGACCACGTATACCTATGGGCTTGGGATCCCGGCCACGGCGCTGGTTGTTGGAAGC
GACACGGTGTCGATTGGCCCGTCGGGAGTGTCGGTCCATGGCCGGCGGCTGGGCGGACAAACGGCGGGCGTTGGA
GCCATGGACTTTGAGGCCATTGGCGGCAATGCCATTACTGAGATTGGGCCCAGCCTGGCCGTCATTGACCATACA
ACGCTGACGGTTGGGCCCGGAAGCCCCCAGACGACCAGAGTCATTGCCGGCAGCACGTATACCCTCGGCCCGGGA
GGCATCACAGCCTCGGGCTGGACCTTGGCCTATCCGTTTGGCCAGGAAATCGTCACCACGTTTTACCCAGCCCGC
TCAAGACAGGCGGCGCTGGCAGTGGAGACGGCGCCGGCCATGGACCTGGGCACCCCCGACGGCGGCCAACAAGGC
GGCGCCAGTGGTGGACACGGGCGTGCCCAGGGCAAGAAGGGTAGCATAAAAAAGGGGGCAGCCGCGTCGCTCAAG
GCGCCAGTAGCTTTTTGCATAGCAATGGGAGTTGTCTGCCTTTTTTAG
Gene >OphauG2|5094
ATGAGGTTCTCAGCCCTGTGCCTTGCCAGCGCTCTCGAGCTATGCGCTGCCTCGACCTTTGTAGCACGCCGTATG
TCCTTGCTTTGCTGCCGCTTGGAGCTGACGCCAACTAACACGTTTGTTGTCCAGACCCAGCCGCCAGCAGGTCTT
TGTATCCTGTGGCCAACACCAGCCGCCCTCTCGACTCCTCCACCTCTTTTACTTCCTCTCCTACTCTGGACGCTG
CCGCCCTACTCTTGCCCTCTTCTGCCGCCACCAATGGCTCCACAAGCGCCTTGTCGTGGGTTCCGGCAACATCGA
CGCCCTCAACCTCGTTTAACCAGACAGCCAACGCCCAAAGACATGTCGCTCCCACACCTGCATCATCATCGCCAT
CATCATCATCAGACTTTGCCACACGGGCCAACCTGACCTTGACTACCCCCCCTCAGCCTCTGATTACGCCAGCGC
CATCCCAGGGACTCTTTTTGACGGTGACGGTCGACTGCGCAAATTCCTGGAACCGTACAGAGTGTCGCTTTGCGC
CCTCGGGCAACATGACGAGAATCTTCCGGCCTATGCCGCCCAAAACAATCAATGCGGACGAGTGTACCACCATGT
CGGACCCTGAAAGGGCCGCGACCAGTATCTCCGTCGTGTACACGTCAACCGTGACGGTATGGGGAAATAGAAGCG
CCTATACGCCGCCATATGAGCCCATGATTTTGCCCAACTATTGTCCTACGGAAAGCTTTGAACCAATCGATTGGA
ACGCCTTGCTGGCGTCTGATTTCTATTCCAAAGTCATGATTCATGAGTCGTATGACCACGCTATGGATAGATTTA
CAATACCGCAGCCCCGCATGGCCTTTACTTTTATCACGACAGCCAAGAACCCTTCGGTCGTTTACTCGGAAGAGC
CTGCTCCCGAGTACAGTCCGTCGTGGAATTCGCCCGGCGACAAGGATGGTGGCGCCCACAAGCCAGCGCTTCAAG
AGGGCGAGAATGCCAGAGCGCCACCTGCCAATAAAGGCAATCACAAACCCATGGCCGATTCCAAGCATGTAGATG
GATCAAGGCCAGTCGACAATGGCGAGCCTAGTAGCAGCAATGCCAAGCCAGGTAACAATGCCAAGCCAGTCGCGA
AGCCCAAGCCAGTTGGCAATTCCAATCCAGTCGACAATTCCAAGCCAGTCGACAGACCAAGCCCAGTCGGCAATT
CCAAACCAGTCGACAGATCAAGACCAGTCGACAGTTCAAAGCTCATTGACAATTCCAAGCCCGCCGACAAGCCCA
AGGCAGCACCACCCGACGCGGCGGGACAGCCTTTGAATCAAGGGAAACAAGATGTCGGATTAGTCGGTCCGCCTG
GCTCGCATCTCAACGGCGGCTTTGGTGCTGCGCCTGACACAGACAGACACGGAGTCGTGGCCCCTCCACGACCAA
GCTTCACCATTGCCGCTCGCGCCTCACAAGTGGCGATTAATGGACAGACGATTTCAGATTTGGGCTTTGGGCAGA
CATCGGTAGTAAATGTGCAAGGAAGCGCCTTTACCATTTTCCCGAGCTCAGTTGTCGGGCAGGGGAGCACGTTGA
GGAAGCCTGCACCAGGCCCAACGGGCGTATGGATTTCGACGCCAACAGCTGCCCTTGTTGGCGGGCTCCCTGTCA
CGGTCAGGGGCCGCAAGGCCGTTATTGCCGGCTCCACCATGGATATACCCGAGACAGCCACAAGCACCGTGATTC
AGGGCCAGCCCGTCGCTCTTGGGCCGGGGTCTCTTGTCGTGGGCCACGAGTCGCTGGCCTTCCAAGCCGTGTTTC
CATGGCGAGAAACGCACGTCATGGTCAAGGACGCGCAGCTCATTACAGCCAGTGGGCGCAGTGTCGTTGTGGTGC
ACTCGACCACGTATACCTATGGGCTTGGGATCCCGGCCACGGCGCTGGTTGTTGGAAGCGACACGGTGTCGATTG
GCCCGTCGGGAGTGTCGGTCCATGGCCGGCGGCTGGGCGGACAAACGGCGGGCGTTGGAGCCATGGACTTTGAGG
CCATTGGCGGCAATGCCATTACTGAGATTGGGCCCAGCCTGGCCGTCATTGACCATACAACGCTGACGGTTGGGC
CCGGAAGCCCCCAGACGACCAGAGTCATTGCCGGCAGCACGTATACCCTCGGCCCGGGAGGCATCACAGCCTCGG
GCTGGACCTTGGCCTATCCGTTTGGCCAGGAAATCGTCACCACGTTTTACCCAGCCCGCTCAAGACAGGCGGCGC
TGGCAGTGGAGACGGCGCCGGCCATGGACCTGGGCACCCCCGACGGCGGCCAACAAGGCGGCGCCAGTGGTGGAC
ACGGGCGTGCCCAGGGCAAGAAGGGTAGCATAAAAAAGGGGGCAGCCGCGTCGCTCAAGGCGCCAGTAGCTTTTT
GCATAGCAATGGGAGTTGTCTGCCTTTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail