Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5089
Gene name
LocationContig_451:42..1416
Strand+
Gene length (bp)1374
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 1.2E-17 77 372
PF07969 Amidohydro_3 Amidohydrolase family 1.6E-08 194 371

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2K4Q9|ADEC2_RHIEC Adenine deaminase 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ade2 PE=3 SV=1 23 395 1.0E-06
sp|Q92VC6|ADEC2_RHIME Adenine deaminase 2 OS=Rhizobium meliloti (strain 1021) GN=ade2 PE=3 SV=1 30 394 1.0E-06

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999753

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup811
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5089 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|144
Ophiocordyceps australis map64 (Brazil) OphauB2|2380
Ophiocordyceps camponoti-floridani Ophcf2|00020
Ophiocordyceps camponoti-rufipedis Ophun1|2813
Ophiocordyceps kimflemingae Ophio5|4078
Ophiocordyceps subramaniannii Hirsu2|3739
Ophiocordyceps subramaniannii Hirsu2|6049

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5089
MHSQSWIKAACLLASLYTAQAENLSITNVNVIDTATGKVAEGQDITVQGNKITSISNGGGKQKRQNGGKTIDGTG
MFAIPGLCDMHTHAYFTNDAQRFPATDNIIFPLYIANGVTCIRDLGSNLGAIKSGRDRIAAHQLEGPRIFFTGPM
LDGPDSGFQTIFNLTDPKQVPGVIKQLKDAGASSVKTHLRMSEQVFDAIATESKKAGLPFGGHVPDDTNAQHAVD
MGMTYIEHMSRLDGQELSQKLISQMSQQQTQQCPTLKLSPFAERLEQTKTLFDAKIPFVAGTDSPAGGNLCPGRT
MLDELVLINKAGLSTAQTLQTATVNAAQVLGQKTMGTLAQGNVADMVLLSANPLQDMNNIRKIEAVVADGQLFDK
QKIDGFQQLQAKLSQCDEPPSADVGPDRRKGQGQQQSGGQKSGKKARGNNRNRAAGAKRNGGNNKSRNRREEIPV
FHCCTLH*
Coding >OphauG2|5089
ATGCATTCACAAAGCTGGATCAAGGCGGCCTGCCTCCTAGCATCGCTCTACACCGCGCAGGCCGAAAACTTGTCC
ATTACAAACGTCAACGTCATCGACACCGCCACGGGCAAAGTGGCCGAGGGCCAGGACATCACGGTGCAGGGCAAC
AAGATCACGTCCATCTCAAACGGAGGCGGCAAGCAGAAGAGGCAGAATGGCGGCAAGACCATTGACGGCACTGGC
ATGTTTGCCATTCCCGGCCTCTGCGACATGCACACGCACGCCTACTTTACCAATGACGCCCAGAGGTTCCCGGCG
ACAGACAACATCATCTTCCCGCTCTACATTGCCAATGGCGTGACGTGCATCCGCGATCTGGGCAGCAACTTGGGA
GCCATCAAGTCTGGGCGCGACAGGATCGCAGCCCATCAGCTCGAGGGCCCGCGCATCTTCTTCACCGGCCCCATG
CTCGACGGGCCTGATTCAGGCTTCCAGACGATTTTCAACCTCACGGACCCTAAACAGGTGCCTGGAGTAATCAAG
CAGCTCAAGGACGCTGGCGCCAGCTCGGTCAAGACGCATCTGCGGATGTCTGAGCAAGTCTTTGATGCCATTGCC
ACAGAGTCCAAAAAGGCAGGCCTGCCGTTTGGCGGCCATGTTCCCGATGACACCAACGCACAGCACGCCGTGGAC
ATGGGCATGACTTACATCGAGCACATGAGCCGCCTTGACGGCCAGGAATTGTCGCAGAAACTCATCTCGCAAATG
TCCCAGCAGCAGACCCAGCAGTGTCCCACGCTCAAGCTCTCGCCCTTTGCCGAGCGCCTCGAGCAGACCAAGACG
CTCTTTGATGCCAAGATCCCCTTTGTGGCCGGAACAGACTCCCCTGCTGGCGGGAATCTGTGCCCGGGCCGCACC
ATGCTCGACGAGCTGGTGCTGATCAACAAGGCCGGCCTGTCCACCGCCCAGACCCTGCAGACGGCCACGGTCAAT
GCCGCCCAGGTGCTCGGCCAGAAGACCATGGGAACCCTGGCCCAGGGCAATGTCGCCGACATGGTGCTGCTGAGC
GCCAACCCCTTGCAGGACATGAACAACATTCGCAAGATTGAGGCCGTCGTGGCTGATGGTCAGCTGTTTGATAAG
CAAAAGATTGACGGCTTCCAGCAGCTCCAGGCAAAGCTGTCTCAGTGCGATGAGCCGCCCAGCGCCGACGTTGGC
CCTGACAGGAGAAAGGGCCAAGGCCAGCAGCAATCCGGCGGCCAGAAATCGGGTAAGAAGGCTCGCGGCAACAAC
CGCAACAGGGCTGCTGGCGCCAAGAGGAATGGGGGCAACAACAAGTCTCGGAACAGGAGGGAAGAGATTCCCGTC
TTCCACTGCTGCACTCTGCACTAG
Transcript >OphauG2|5089
ATGCATTCACAAAGCTGGATCAAGGCGGCCTGCCTCCTAGCATCGCTCTACACCGCGCAGGCCGAAAACTTGTCC
ATTACAAACGTCAACGTCATCGACACCGCCACGGGCAAAGTGGCCGAGGGCCAGGACATCACGGTGCAGGGCAAC
AAGATCACGTCCATCTCAAACGGAGGCGGCAAGCAGAAGAGGCAGAATGGCGGCAAGACCATTGACGGCACTGGC
ATGTTTGCCATTCCCGGCCTCTGCGACATGCACACGCACGCCTACTTTACCAATGACGCCCAGAGGTTCCCGGCG
ACAGACAACATCATCTTCCCGCTCTACATTGCCAATGGCGTGACGTGCATCCGCGATCTGGGCAGCAACTTGGGA
GCCATCAAGTCTGGGCGCGACAGGATCGCAGCCCATCAGCTCGAGGGCCCGCGCATCTTCTTCACCGGCCCCATG
CTCGACGGGCCTGATTCAGGCTTCCAGACGATTTTCAACCTCACGGACCCTAAACAGGTGCCTGGAGTAATCAAG
CAGCTCAAGGACGCTGGCGCCAGCTCGGTCAAGACGCATCTGCGGATGTCTGAGCAAGTCTTTGATGCCATTGCC
ACAGAGTCCAAAAAGGCAGGCCTGCCGTTTGGCGGCCATGTTCCCGATGACACCAACGCACAGCACGCCGTGGAC
ATGGGCATGACTTACATCGAGCACATGAGCCGCCTTGACGGCCAGGAATTGTCGCAGAAACTCATCTCGCAAATG
TCCCAGCAGCAGACCCAGCAGTGTCCCACGCTCAAGCTCTCGCCCTTTGCCGAGCGCCTCGAGCAGACCAAGACG
CTCTTTGATGCCAAGATCCCCTTTGTGGCCGGAACAGACTCCCCTGCTGGCGGGAATCTGTGCCCGGGCCGCACC
ATGCTCGACGAGCTGGTGCTGATCAACAAGGCCGGCCTGTCCACCGCCCAGACCCTGCAGACGGCCACGGTCAAT
GCCGCCCAGGTGCTCGGCCAGAAGACCATGGGAACCCTGGCCCAGGGCAATGTCGCCGACATGGTGCTGCTGAGC
GCCAACCCCTTGCAGGACATGAACAACATTCGCAAGATTGAGGCCGTCGTGGCTGATGGTCAGCTGTTTGATAAG
CAAAAGATTGACGGCTTCCAGCAGCTCCAGGCAAAGCTGTCTCAGTGCGATGAGCCGCCCAGCGCCGACGTTGGC
CCTGACAGGAGAAAGGGCCAAGGCCAGCAGCAATCCGGCGGCCAGAAATCGGGTAAGAAGGCTCGCGGCAACAAC
CGCAACAGGGCTGCTGGCGCCAAGAGGAATGGGGGCAACAACAAGTCTCGGAACAGGAGGGAAGAGATTCCCGTC
TTCCACTGCTGCACTCTGCACTAG
Gene >OphauG2|5089
ATGCATTCACAAAGCTGGATCAAGGCGGCCTGCCTCCTAGCATCGCTCTACACCGCGCAGGCCGAAAACTTGTCC
ATTACAAACGTCAACGTCATCGACACCGCCACGGGCAAAGTGGCCGAGGGCCAGGACATCACGGTGCAGGGCAAC
AAGATCACGTCCATCTCAAACGGAGGCGGCAAGCAGAAGAGGCAGAATGGCGGCAAGACCATTGACGGCACTGGC
ATGTTTGCCATTCCCGGCCTCTGCGACATGCACACGCACGCCTACTTTACCAATGACGCCCAGAGGTTCCCGGCG
ACAGACAACATCATCTTCCCGCTCTACATTGCCAATGGCGTGACGTGCATCCGCGATCTGGGCAGCAACTTGGGA
GCCATCAAGTCTGGGCGCGACAGGATCGCAGCCCATCAGCTCGAGGGCCCGCGCATCTTCTTCACCGGCCCCATG
CTCGACGGGCCTGATTCAGGCTTCCAGACGATTTTCAACCTCACGGACCCTAAACAGGTGCCTGGAGTAATCAAG
CAGCTCAAGGACGCTGGCGCCAGCTCGGTCAAGACGCATCTGCGGATGTCTGAGCAAGTCTTTGATGCCATTGCC
ACAGAGTCCAAAAAGGCAGGCCTGCCGTTTGGCGGCCATGTTCCCGATGACACCAACGCACAGCACGCCGTGGAC
ATGGGCATGACTTACATCGAGCACATGAGCCGCCTTGACGGCCAGGAATTGTCGCAGAAACTCATCTCGCAAATG
TCCCAGCAGCAGACCCAGCAGTGTCCCACGCTCAAGCTCTCGCCCTTTGCCGAGCGCCTCGAGCAGACCAAGACG
CTCTTTGATGCCAAGATCCCCTTTGTGGCCGGAACAGACTCCCCTGCTGGCGGGAATCTGTGCCCGGGCCGCACC
ATGCTCGACGAGCTGGTGCTGATCAACAAGGCCGGCCTGTCCACCGCCCAGACCCTGCAGACGGCCACGGTCAAT
GCCGCCCAGGTGCTCGGCCAGAAGACCATGGGAACCCTGGCCCAGGGCAATGTCGCCGACATGGTGCTGCTGAGC
GCCAACCCCTTGCAGGACATGAACAACATTCGCAAGATTGAGGCCGTCGTGGCTGATGGTCAGCTGTTTGATAAG
CAAAAGATTGACGGCTTCCAGCAGCTCCAGGCAAAGCTGTCTCAGTGCGATGAGCCGCCCAGCGCCGACGTTGGC
CCTGACAGGAGAAAGGGCCAAGGCCAGCAGCAATCCGGCGGCCAGAAATCGGGTAAGAAGGCTCGCGGCAACAAC
CGCAACAGGGCTGCTGGCGCCAAGAGGAATGGGGGCAACAACAAGTCTCGGAACAGGAGGGAAGAGATTCCCGTC
TTCCACTGCTGCACTCTGCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail