Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5089
Gene name
LocationContig_451:42..1416
Strand+
Gene length (bp)1374
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 1.2E-17 77 372
PF07969 Amidohydro_3 Amidohydrolase family 1.6E-08 194 371

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2K4Q9|ADEC2_RHIEC Adenine deaminase 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ade2 PE=3 SV=1 23 395 1.0E-06
sp|Q92VC6|ADEC2_RHIME Adenine deaminase 2 OS=Rhizobium meliloti (strain 1021) GN=ade2 PE=3 SV=1 30 394 1.0E-06

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5089
MHSQSWIKAACLLASLYTAQAENLSITNVNVIDTATGKVAEGQDITVQGNKITSISNGGGKQKRQNGGKTIDGTG
MFAIPGLCDMHTHAYFTNDAQRFPATDNIIFPLYIANGVTCIRDLGSNLGAIKSGRDRIAAHQLEGPRIFFTGPM
LDGPDSGFQTIFNLTDPKQVPGVIKQLKDAGASSVKTHLRMSEQVFDAIATESKKAGLPFGGHVPDDTNAQHAVD
MGMTYIEHMSRLDGQELSQKLISQMSQQQTQQCPTLKLSPFAERLEQTKTLFDAKIPFVAGTDSPAGGNLCPGRT
MLDELVLINKAGLSTAQTLQTATVNAAQVLGQKTMGTLAQGNVADMVLLSANPLQDMNNIRKIEAVVADGQLFDK
QKIDGFQQLQAKLSQCDEPPSADVGPDRRKGQGQQQSGGQKSGKKARGNNRNRAAGAKRNGGNNKSRNRREEIPV
FHCCTLH*
Coding >OphauG2|5089
ATGCATTCACAAAGCTGGATCAAGGCGGCCTGCCTCCTAGCATCGCTCTACACCGCGCAGGCCGAAAACTTGTCC
ATTACAAACGTCAACGTCATCGACACCGCCACGGGCAAAGTGGCCGAGGGCCAGGACATCACGGTGCAGGGCAAC
AAGATCACGTCCATCTCAAACGGAGGCGGCAAGCAGAAGAGGCAGAATGGCGGCAAGACCATTGACGGCACTGGC
ATGTTTGCCATTCCCGGCCTCTGCGACATGCACACGCACGCCTACTTTACCAATGACGCCCAGAGGTTCCCGGCG
ACAGACAACATCATCTTCCCGCTCTACATTGCCAATGGCGTGACGTGCATCCGCGATCTGGGCAGCAACTTGGGA
GCCATCAAGTCTGGGCGCGACAGGATCGCAGCCCATCAGCTCGAGGGCCCGCGCATCTTCTTCACCGGCCCCATG
CTCGACGGGCCTGATTCAGGCTTCCAGACGATTTTCAACCTCACGGACCCTAAACAGGTGCCTGGAGTAATCAAG
CAGCTCAAGGACGCTGGCGCCAGCTCGGTCAAGACGCATCTGCGGATGTCTGAGCAAGTCTTTGATGCCATTGCC
ACAGAGTCCAAAAAGGCAGGCCTGCCGTTTGGCGGCCATGTTCCCGATGACACCAACGCACAGCACGCCGTGGAC
ATGGGCATGACTTACATCGAGCACATGAGCCGCCTTGACGGCCAGGAATTGTCGCAGAAACTCATCTCGCAAATG
TCCCAGCAGCAGACCCAGCAGTGTCCCACGCTCAAGCTCTCGCCCTTTGCCGAGCGCCTCGAGCAGACCAAGACG
CTCTTTGATGCCAAGATCCCCTTTGTGGCCGGAACAGACTCCCCTGCTGGCGGGAATCTGTGCCCGGGCCGCACC
ATGCTCGACGAGCTGGTGCTGATCAACAAGGCCGGCCTGTCCACCGCCCAGACCCTGCAGACGGCCACGGTCAAT
GCCGCCCAGGTGCTCGGCCAGAAGACCATGGGAACCCTGGCCCAGGGCAATGTCGCCGACATGGTGCTGCTGAGC
GCCAACCCCTTGCAGGACATGAACAACATTCGCAAGATTGAGGCCGTCGTGGCTGATGGTCAGCTGTTTGATAAG
CAAAAGATTGACGGCTTCCAGCAGCTCCAGGCAAAGCTGTCTCAGTGCGATGAGCCGCCCAGCGCCGACGTTGGC
CCTGACAGGAGAAAGGGCCAAGGCCAGCAGCAATCCGGCGGCCAGAAATCGGGTAAGAAGGCTCGCGGCAACAAC
CGCAACAGGGCTGCTGGCGCCAAGAGGAATGGGGGCAACAACAAGTCTCGGAACAGGAGGGAAGAGATTCCCGTC
TTCCACTGCTGCACTCTGCACTAG
Transcript >OphauG2|5089
ATGCATTCACAAAGCTGGATCAAGGCGGCCTGCCTCCTAGCATCGCTCTACACCGCGCAGGCCGAAAACTTGTCC
ATTACAAACGTCAACGTCATCGACACCGCCACGGGCAAAGTGGCCGAGGGCCAGGACATCACGGTGCAGGGCAAC
AAGATCACGTCCATCTCAAACGGAGGCGGCAAGCAGAAGAGGCAGAATGGCGGCAAGACCATTGACGGCACTGGC
ATGTTTGCCATTCCCGGCCTCTGCGACATGCACACGCACGCCTACTTTACCAATGACGCCCAGAGGTTCCCGGCG
ACAGACAACATCATCTTCCCGCTCTACATTGCCAATGGCGTGACGTGCATCCGCGATCTGGGCAGCAACTTGGGA
GCCATCAAGTCTGGGCGCGACAGGATCGCAGCCCATCAGCTCGAGGGCCCGCGCATCTTCTTCACCGGCCCCATG
CTCGACGGGCCTGATTCAGGCTTCCAGACGATTTTCAACCTCACGGACCCTAAACAGGTGCCTGGAGTAATCAAG
CAGCTCAAGGACGCTGGCGCCAGCTCGGTCAAGACGCATCTGCGGATGTCTGAGCAAGTCTTTGATGCCATTGCC
ACAGAGTCCAAAAAGGCAGGCCTGCCGTTTGGCGGCCATGTTCCCGATGACACCAACGCACAGCACGCCGTGGAC
ATGGGCATGACTTACATCGAGCACATGAGCCGCCTTGACGGCCAGGAATTGTCGCAGAAACTCATCTCGCAAATG
TCCCAGCAGCAGACCCAGCAGTGTCCCACGCTCAAGCTCTCGCCCTTTGCCGAGCGCCTCGAGCAGACCAAGACG
CTCTTTGATGCCAAGATCCCCTTTGTGGCCGGAACAGACTCCCCTGCTGGCGGGAATCTGTGCCCGGGCCGCACC
ATGCTCGACGAGCTGGTGCTGATCAACAAGGCCGGCCTGTCCACCGCCCAGACCCTGCAGACGGCCACGGTCAAT
GCCGCCCAGGTGCTCGGCCAGAAGACCATGGGAACCCTGGCCCAGGGCAATGTCGCCGACATGGTGCTGCTGAGC
GCCAACCCCTTGCAGGACATGAACAACATTCGCAAGATTGAGGCCGTCGTGGCTGATGGTCAGCTGTTTGATAAG
CAAAAGATTGACGGCTTCCAGCAGCTCCAGGCAAAGCTGTCTCAGTGCGATGAGCCGCCCAGCGCCGACGTTGGC
CCTGACAGGAGAAAGGGCCAAGGCCAGCAGCAATCCGGCGGCCAGAAATCGGGTAAGAAGGCTCGCGGCAACAAC
CGCAACAGGGCTGCTGGCGCCAAGAGGAATGGGGGCAACAACAAGTCTCGGAACAGGAGGGAAGAGATTCCCGTC
TTCCACTGCTGCACTCTGCACTAG
Gene >OphauG2|5089
ATGCATTCACAAAGCTGGATCAAGGCGGCCTGCCTCCTAGCATCGCTCTACACCGCGCAGGCCGAAAACTTGTCC
ATTACAAACGTCAACGTCATCGACACCGCCACGGGCAAAGTGGCCGAGGGCCAGGACATCACGGTGCAGGGCAAC
AAGATCACGTCCATCTCAAACGGAGGCGGCAAGCAGAAGAGGCAGAATGGCGGCAAGACCATTGACGGCACTGGC
ATGTTTGCCATTCCCGGCCTCTGCGACATGCACACGCACGCCTACTTTACCAATGACGCCCAGAGGTTCCCGGCG
ACAGACAACATCATCTTCCCGCTCTACATTGCCAATGGCGTGACGTGCATCCGCGATCTGGGCAGCAACTTGGGA
GCCATCAAGTCTGGGCGCGACAGGATCGCAGCCCATCAGCTCGAGGGCCCGCGCATCTTCTTCACCGGCCCCATG
CTCGACGGGCCTGATTCAGGCTTCCAGACGATTTTCAACCTCACGGACCCTAAACAGGTGCCTGGAGTAATCAAG
CAGCTCAAGGACGCTGGCGCCAGCTCGGTCAAGACGCATCTGCGGATGTCTGAGCAAGTCTTTGATGCCATTGCC
ACAGAGTCCAAAAAGGCAGGCCTGCCGTTTGGCGGCCATGTTCCCGATGACACCAACGCACAGCACGCCGTGGAC
ATGGGCATGACTTACATCGAGCACATGAGCCGCCTTGACGGCCAGGAATTGTCGCAGAAACTCATCTCGCAAATG
TCCCAGCAGCAGACCCAGCAGTGTCCCACGCTCAAGCTCTCGCCCTTTGCCGAGCGCCTCGAGCAGACCAAGACG
CTCTTTGATGCCAAGATCCCCTTTGTGGCCGGAACAGACTCCCCTGCTGGCGGGAATCTGTGCCCGGGCCGCACC
ATGCTCGACGAGCTGGTGCTGATCAACAAGGCCGGCCTGTCCACCGCCCAGACCCTGCAGACGGCCACGGTCAAT
GCCGCCCAGGTGCTCGGCCAGAAGACCATGGGAACCCTGGCCCAGGGCAATGTCGCCGACATGGTGCTGCTGAGC
GCCAACCCCTTGCAGGACATGAACAACATTCGCAAGATTGAGGCCGTCGTGGCTGATGGTCAGCTGTTTGATAAG
CAAAAGATTGACGGCTTCCAGCAGCTCCAGGCAAAGCTGTCTCAGTGCGATGAGCCGCCCAGCGCCGACGTTGGC
CCTGACAGGAGAAAGGGCCAAGGCCAGCAGCAATCCGGCGGCCAGAAATCGGGTAAGAAGGCTCGCGGCAACAAC
CGCAACAGGGCTGCTGGCGCCAAGAGGAATGGGGGCAACAACAAGTCTCGGAACAGGAGGGAAGAGATTCCCGTC
TTCCACTGCTGCACTCTGCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail