Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5088
Gene name
LocationContig_450:13586..14498
Strand-
Gene length (bp)912
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01975 SurE Survival protein SurE 4.5E-33 24 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30887|PHO2_YARLI Acid phosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO2 PE=3 SV=2 24 275 1.0E-17
sp|B0K177|SURE_THEPX 5'-nucleotidase SurE OS=Thermoanaerobacter sp. (strain X514) GN=surE PE=3 SV=1 23 222 9.0E-13
sp|B0K9J0|SURE_THEP3 5'-nucleotidase SurE OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=surE PE=3 SV=1 23 222 9.0E-13
sp|B2VA83|SURE_SULSY 5'-nucleotidase SurE OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=surE PE=3 SV=1 24 219 2.0E-12
sp|B8FC91|SURE_DESAA 5'-nucleotidase SurE OS=Desulfatibacillum alkenivorans (strain AK-01) GN=surE PE=3 SV=1 23 219 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30887|PHO2_YARLI Acid phosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO2 PE=3 SV=2 24 275 1.0E-17
sp|B0K177|SURE_THEPX 5'-nucleotidase SurE OS=Thermoanaerobacter sp. (strain X514) GN=surE PE=3 SV=1 23 222 9.0E-13
sp|B0K9J0|SURE_THEP3 5'-nucleotidase SurE OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=surE PE=3 SV=1 23 222 9.0E-13
sp|B2VA83|SURE_SULSY 5'-nucleotidase SurE OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=surE PE=3 SV=1 24 219 2.0E-12
sp|B8FC91|SURE_DESAA 5'-nucleotidase SurE OS=Desulfatibacillum alkenivorans (strain AK-01) GN=surE PE=3 SV=1 23 219 5.0E-12
sp|B3CLR5|SURE_WOLPP 5'-nucleotidase SurE OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=surE PE=3 SV=1 24 219 1.0E-11
sp|Q3YSH3|SURE_EHRCJ 5'-nucleotidase SurE OS=Ehrlichia canis (strain Jake) GN=surE PE=3 SV=1 24 219 5.0E-11
sp|Q7NNG7|SURE_GLOVI 5'-nucleotidase SurE OS=Gloeobacter violaceus (strain PCC 7421) GN=surE PE=3 SV=1 24 219 3.0E-10
sp|Q0W2Q3|SURE_METAR 5'-nucleotidase SurE OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=surE PE=3 SV=1 24 226 4.0E-10
sp|Q1MQB1|SURE_LAWIP 5'-nucleotidase SurE OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=surE PE=3 SV=1 23 219 4.0E-10
sp|A5CVV1|SURE_VESOH 5'-nucleotidase SurE OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=surE PE=3 SV=1 24 219 5.0E-10
sp|B0JX00|SURE_MICAN 5'-nucleotidase SurE OS=Microcystis aeruginosa (strain NIES-843) GN=surE PE=3 SV=1 23 219 5.0E-10
sp|A0M5L6|SURE_GRAFK 5'-nucleotidase SurE OS=Gramella forsetii (strain KT0803) GN=surE PE=3 SV=1 24 222 7.0E-10
sp|A4SYE9|SURE_POLSQ 5'-nucleotidase SurE OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=surE PE=3 SV=1 23 238 7.0E-10
sp|A5D2G6|SURE_PELTS 5'-nucleotidase SurE OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=surE PE=3 SV=1 24 225 8.0E-10
sp|A5EY39|SURE_DICNV 5'-nucleotidase SurE OS=Dichelobacter nodosus (strain VCS1703A) GN=surE PE=3 SV=1 24 219 9.0E-10
sp|Q73G84|SURE_WOLPM 5'-nucleotidase SurE OS=Wolbachia pipientis wMel GN=surE PE=3 SV=1 24 219 1.0E-09
sp|Q390V3|SURE1_BURL3 5'-nucleotidase SurE 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=surE1 PE=3 SV=1 24 232 1.0E-09
sp|A5FK02|SURE_FLAJ1 5'-nucleotidase SurE OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=surE PE=3 SV=1 96 220 1.0E-09
sp|Q5PB34|SURE_ANAMM 5'-nucleotidase SurE OS=Anaplasma marginale (strain St. Maries) GN=surE PE=3 SV=1 24 233 2.0E-09
sp|C4XNX3|SURE_DESMR 5'-nucleotidase SurE OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=surE PE=3 SV=1 24 255 2.0E-09
sp|B9KI89|SURE_ANAMF 5'-nucleotidase SurE OS=Anaplasma marginale (strain Florida) GN=surE PE=3 SV=1 24 233 2.0E-09
sp|C0R4G7|SURE_WOLWR 5'-nucleotidase SurE OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=surE PE=3 SV=1 24 219 3.0E-09
sp|Q5HWH7|SURE_CAMJR 5'-nucleotidase SurE OS=Campylobacter jejuni (strain RM1221) GN=surE PE=3 SV=1 24 219 3.0E-09
sp|Q9PIK6|SURE_CAMJE 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=surE PE=3 SV=1 24 219 3.0E-09
sp|A8FK82|SURE_CAMJ8 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=surE PE=3 SV=1 24 219 3.0E-09
sp|A1VY14|SURE_CAMJJ 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=surE PE=3 SV=1 24 219 3.0E-09
sp|B8J2G2|SURE_DESDA 5'-nucleotidase SurE OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=surE PE=3 SV=1 23 219 3.0E-09
sp|A5HYC6|SURE_CLOBH 5'-nucleotidase SurE OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=surE PE=3 SV=1 23 219 4.0E-09
sp|A7FQP3|SURE_CLOB1 5'-nucleotidase SurE OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=surE PE=3 SV=1 23 219 4.0E-09
sp|Q39FP8|SURE2_BURL3 5'-nucleotidase SurE 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=surE2 PE=3 SV=1 24 238 5.0E-09
sp|C3KZ52|SURE_CLOB6 5'-nucleotidase SurE OS=Clostridium botulinum (strain 657 / Type Ba4) GN=surE PE=3 SV=1 23 219 6.0E-09
sp|Q12PY9|SURE_SHEDO 5'-nucleotidase SurE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=surE PE=3 SV=1 23 219 6.0E-09
sp|Q24WI0|SURE_DESHY 5'-nucleotidase SurE OS=Desulfitobacterium hafniense (strain Y51) GN=surE PE=3 SV=1 23 168 8.0E-09
sp|B8FYS8|SURE_DESHD 5'-nucleotidase SurE OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=surE PE=3 SV=1 23 168 8.0E-09
sp|Q5N0F0|SURE_SYNP6 5'-nucleotidase SurE OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=surE PE=3 SV=1 23 219 8.0E-09
sp|Q31LH6|SURE_SYNE7 5'-nucleotidase SurE OS=Synechococcus elongatus (strain PCC 7942) GN=surE PE=3 SV=1 23 219 8.0E-09
sp|A6H213|SURE_FLAPJ 5'-nucleotidase SurE OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=surE PE=3 SV=1 98 222 8.0E-09
sp|B1KTK1|SURE_CLOBM 5'-nucleotidase SurE OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=surE PE=3 SV=1 23 219 9.0E-09
sp|A1S4E2|SURE_SHEAM 5'-nucleotidase SurE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=surE PE=3 SV=1 24 219 9.0E-09
sp|A4JEQ1|SURE_BURVG 5'-nucleotidase SurE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=surE PE=3 SV=1 24 238 9.0E-09
sp|Q0K950|SURE_CUPNH 5'-nucleotidase SurE OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=surE PE=3 SV=1 23 219 9.0E-09
sp|A7G9Y6|SURE_CLOBL 5'-nucleotidase SurE OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=surE PE=3 SV=1 23 219 1.0E-08
sp|B1IDC2|SURE_CLOBK 5'-nucleotidase SurE OS=Clostridium botulinum (strain Okra / Type B1) GN=surE PE=3 SV=1 23 219 1.0E-08
sp|Q8Y040|SURE_RALSO 5'-nucleotidase SurE OS=Ralstonia solanacearum (strain GMI1000) GN=surE PE=3 SV=1 23 238 1.0E-08
sp|A9BBN4|SURE_PROM4 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9211) GN=surE PE=3 SV=1 24 238 1.0E-08
sp|A8ZXL1|SURE_DESOH 5'-nucleotidase SurE OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=surE PE=3 SV=1 23 219 1.0E-08
sp|B1WXT3|SURE_CYAA5 5'-nucleotidase SurE OS=Cyanothece sp. (strain ATCC 51142) GN=surE PE=3 SV=1 23 237 1.0E-08
sp|Q2RJD1|SURE_MOOTA 5'-nucleotidase SurE OS=Moorella thermoacetica (strain ATCC 39073) GN=surE PE=3 SV=1 24 219 1.0E-08
sp|C1FQW9|SURE_CLOBJ 5'-nucleotidase SurE OS=Clostridium botulinum (strain Kyoto / Type A2) GN=surE PE=3 SV=1 23 219 1.0E-08
sp|Q46ZH1|SURE_CUPPJ 5'-nucleotidase SurE OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=surE PE=3 SV=1 23 220 1.0E-08
sp|A0LHG0|SURE_SYNFM 5'-nucleotidase SurE OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=surE PE=3 SV=1 24 223 1.0E-08
sp|Q8RA90|SURE_CALS4 5'-nucleotidase SurE OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=surE PE=3 SV=1 24 239 2.0E-08
sp|A7H0A1|SURE_CAMC5 5'-nucleotidase SurE OS=Campylobacter curvus (strain 525.92) GN=surE PE=3 SV=1 127 219 2.0E-08
sp|A0KGH8|SURE_AERHH 5'-nucleotidase SurE OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=surE PE=3 SV=1 24 168 2.0E-08
sp|B1XPE2|SURE_SYNP2 5'-nucleotidase SurE OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=surE PE=3 SV=1 23 222 2.0E-08
sp|Q7MHQ7|SURE_VIBVY 5'-nucleotidase SurE OS=Vibrio vulnificus (strain YJ016) GN=surE PE=3 SV=1 24 219 2.0E-08
sp|Q7VAV8|SURE_PROMA 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=surE PE=3 SV=1 24 238 2.0E-08
sp|Q8DC57|SURE_VIBVU 5'-nucleotidase SurE OS=Vibrio vulnificus (strain CMCP6) GN=surE PE=3 SV=1 24 219 3.0E-08
sp|B3R1L4|SURE_CUPTR 5'-nucleotidase SurE OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=surE PE=3 SV=1 23 220 3.0E-08
sp|Q10YV3|SURE_TRIEI 5'-nucleotidase SurE OS=Trichodesmium erythraeum (strain IMS101) GN=surE PE=3 SV=1 24 222 3.0E-08
sp|B7KB74|SURE_CYAP7 5'-nucleotidase SurE OS=Cyanothece sp. (strain PCC 7424) GN=surE PE=3 SV=1 16 237 3.0E-08
sp|A0L4K6|SURE_MAGMM 5'-nucleotidase SurE OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=surE PE=3 SV=1 24 233 4.0E-08
sp|Q8UEQ3|SURE_AGRFC 5'-nucleotidase SurE OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=surE PE=3 SV=1 24 219 4.0E-08
sp|A8EX03|SURE_ARCB4 5'-nucleotidase SurE OS=Arcobacter butzleri (strain RM4018) GN=surE PE=3 SV=1 23 222 4.0E-08
sp|Q3ATV8|SURE_CHLCH 5'-nucleotidase SurE OS=Chlorobium chlorochromatii (strain CaD3) GN=surE PE=3 SV=1 23 219 5.0E-08
sp|Q46JK0|SURE_PROMT 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain NATL2A) GN=surE PE=3 SV=1 23 238 5.0E-08
sp|Q5GS87|SURE_WOLTR 5'-nucleotidase SurE OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=surE PE=3 SV=1 24 172 5.0E-08
sp|B2TPM3|SURE_CLOBB 5'-nucleotidase SurE OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=surE PE=3 SV=1 23 219 6.0E-08
sp|A2C436|SURE_PROM1 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain NATL1A) GN=surE PE=3 SV=1 24 238 6.0E-08
sp|Q0A7L4|SURE_ALKEH 5'-nucleotidase SurE OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=surE PE=3 SV=1 23 219 7.0E-08
sp|A1ASL7|SURE_PELPD 5'-nucleotidase SurE OS=Pelobacter propionicus (strain DSM 2379) GN=surE PE=3 SV=1 23 219 7.0E-08
sp|Q67NP4|SURE_SYMTH 5'-nucleotidase SurE OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=surE PE=3 SV=1 102 239 8.0E-08
sp|B8GRG3|SURE_THISH 5'-nucleotidase SurE OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=surE PE=3 SV=1 24 220 9.0E-08
sp|Q2SWF5|SURE_BURTA 5'-nucleotidase SurE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=surE PE=3 SV=1 24 220 1.0E-07
sp|C4LBQ6|SURE_TOLAT 5'-nucleotidase SurE OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=surE PE=3 SV=1 24 168 1.0E-07
sp|Q1ATN8|SURE_RUBXD 5'-nucleotidase SurE OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=surE PE=3 SV=2 128 239 2.0E-07
sp|O08248|SURE_RHIME 5'-nucleotidase SurE OS=Rhizobium meliloti (strain 1021) GN=surE PE=3 SV=2 127 219 2.0E-07
sp|A8F523|SURE_PSELT 5'-nucleotidase SurE OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=surE PE=3 SV=1 24 220 2.0E-07
sp|Q87LQ5|SURE_VIBPA 5'-nucleotidase SurE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=surE PE=3 SV=1 24 209 2.0E-07
sp|Q72H70|SURE1_THET2 5'-nucleotidase SurE 1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=surE1 PE=3 SV=1 23 222 2.0E-07
sp|A1BI19|SURE_CHLPD 5'-nucleotidase SurE OS=Chlorobium phaeobacteroides (strain DSM 266) GN=surE PE=3 SV=1 23 219 2.0E-07
sp|O67004|SURE_AQUAE 5'-nucleotidase SurE OS=Aquifex aeolicus (strain VF5) GN=surE PE=1 SV=1 28 222 2.0E-07
sp|A7HXK5|SURE_PARL1 5'-nucleotidase SurE OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=surE PE=3 SV=1 24 219 2.0E-07
sp|A1V4L3|SURE_BURMS 5'-nucleotidase SurE OS=Burkholderia mallei (strain SAVP1) GN=surE PE=3 SV=1 24 220 2.0E-07
sp|Q62JV2|SURE_BURMA 5'-nucleotidase SurE OS=Burkholderia mallei (strain ATCC 23344) GN=surE PE=3 SV=1 24 220 2.0E-07
sp|A2S290|SURE_BURM9 5'-nucleotidase SurE OS=Burkholderia mallei (strain NCTC 10229) GN=surE PE=3 SV=1 24 220 2.0E-07
sp|A3MK87|SURE_BURM7 5'-nucleotidase SurE OS=Burkholderia mallei (strain NCTC 10247) GN=surE PE=3 SV=1 24 220 2.0E-07
sp|A3NA65|SURE_BURP6 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 668) GN=surE PE=3 SV=1 24 220 2.0E-07
sp|B1I3V7|SURE_DESAP 5'-nucleotidase SurE OS=Desulforudis audaxviator (strain MP104C) GN=surE PE=3 SV=1 24 171 2.0E-07
sp|Q9RRT8|SURE_DEIRA 5'-nucleotidase SurE OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=surE PE=3 SV=1 127 240 2.0E-07
sp|Q3ADI0|SURE_CARHZ 5'-nucleotidase SurE OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=surE PE=3 SV=1 102 219 2.0E-07
sp|C5CUL9|SURE_VARPS 5'-nucleotidase SurE OS=Variovorax paradoxus (strain S110) GN=surE PE=3 SV=1 24 219 3.0E-07
sp|A4SD83|SURE_CHLPM 5'-nucleotidase SurE OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=surE PE=3 SV=1 24 237 3.0E-07
sp|A2SF75|SURE_METPP 5'-nucleotidase SurE OS=Methylibium petroleiphilum (strain PM1) GN=surE PE=3 SV=2 24 219 3.0E-07
sp|Q6MCW1|SURE_PARUW 5'-nucleotidase SurE OS=Protochlamydia amoebophila (strain UWE25) GN=surE PE=3 SV=1 102 220 3.0E-07
sp|Q63UU4|SURE_BURPS 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain K96243) GN=surE PE=3 SV=1 24 220 3.0E-07
sp|Q3JRP0|SURE_BURP1 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 1710b) GN=surE PE=3 SV=1 24 220 3.0E-07
sp|A3NVY2|SURE_BURP0 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 1106a) GN=surE PE=3 SV=1 24 220 3.0E-07
sp|Q899M5|SURE_CLOTE 5'-nucleotidase SurE OS=Clostridium tetani (strain Massachusetts / E88) GN=surE PE=3 SV=1 24 232 3.0E-07
sp|O27484|SURE_METTH 5'-nucleotidase SurE OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=surE PE=3 SV=1 127 239 3.0E-07
sp|Q2L006|SURE_BORA1 5'-nucleotidase SurE OS=Bordetella avium (strain 197N) GN=surE PE=3 SV=1 24 222 3.0E-07
sp|A8FST3|SURE_SHESH 5'-nucleotidase SurE OS=Shewanella sediminis (strain HAW-EB3) GN=surE PE=3 SV=1 24 168 4.0E-07
sp|B8IN19|SURE_METNO 5'-nucleotidase SurE OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=surE PE=3 SV=1 24 219 4.0E-07
sp|Q3B5Y2|SURE_CHLL7 5'-nucleotidase SurE OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=surE PE=3 SV=1 24 219 4.0E-07
sp|A6Q9V0|SURE_SULNB 5'-nucleotidase SurE OS=Sulfurovum sp. (strain NBC37-1) GN=surE PE=3 SV=1 127 232 4.0E-07
sp|Q6LMT6|SURE_PHOPR 5'-nucleotidase SurE OS=Photobacterium profundum GN=surE PE=3 SV=2 24 219 5.0E-07
sp|B1KPT1|SURE_SHEWM 5'-nucleotidase SurE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=surE PE=3 SV=1 24 219 5.0E-07
sp|A6LL96|SURE_THEM4 5'-nucleotidase SurE OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=surE PE=3 SV=1 23 219 5.0E-07
sp|Q086A5|SURE_SHEFN 5'-nucleotidase SurE OS=Shewanella frigidimarina (strain NCIMB 400) GN=surE PE=3 SV=1 23 219 5.0E-07
sp|Q3J3D0|SURE_RHOS4 5'-nucleotidase SurE OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=surE PE=3 SV=1 128 223 6.0E-07
sp|B9KQZ2|SURE_RHOSK 5'-nucleotidase SurE OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=surE PE=3 SV=1 128 223 6.0E-07
sp|Q5FHG1|SURE_EHRRG 5'-nucleotidase SurE OS=Ehrlichia ruminantium (strain Gardel) GN=surE PE=3 SV=2 24 240 6.0E-07
sp|Q3JCZ4|SURE_NITOC 5'-nucleotidase SurE OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=surE PE=3 SV=1 24 232 6.0E-07
sp|A1WWY6|SURE_HALHL 5'-nucleotidase SurE OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=surE PE=3 SV=1 24 219 6.0E-07
sp|A3PIZ9|SURE_RHOS1 5'-nucleotidase SurE OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=surE PE=3 SV=1 128 223 6.0E-07
sp|Q11HC9|SURE_CHESB 5'-nucleotidase SurE OS=Chelativorans sp. (strain BNC1) GN=surE PE=3 SV=1 128 220 7.0E-07
sp|A9BER9|SURE_PETMO 5'-nucleotidase SurE OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=surE PE=3 SV=1 23 220 7.0E-07
sp|P66880|SURE_BRUSU 5'-nucleotidase SurE OS=Brucella suis biovar 1 (strain 1330) GN=surE PE=3 SV=1 23 219 7.0E-07
sp|A5VQ63|SURE_BRUO2 5'-nucleotidase SurE OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=surE PE=3 SV=2 23 219 7.0E-07
sp|P66879|SURE_BRUME 5'-nucleotidase SurE OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=surE PE=3 SV=1 23 219 7.0E-07
sp|C0RIL9|SURE_BRUMB 5'-nucleotidase SurE OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=surE PE=3 SV=1 23 219 7.0E-07
sp|A9MAQ9|SURE_BRUC2 5'-nucleotidase SurE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=surE PE=3 SV=1 23 219 7.0E-07
sp|A9B1D4|SURE_HERA2 5'-nucleotidase SurE OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=surE PE=3 SV=1 127 239 7.0E-07
sp|Q5HBM5|SURE_EHRRW 5'-nucleotidase SurE OS=Ehrlichia ruminantium (strain Welgevonden) GN=surE PE=3 SV=1 24 240 7.0E-07
sp|A4G4J2|SURE_HERAR 5'-nucleotidase SurE OS=Herminiimonas arsenicoxydans GN=surE PE=3 SV=1 24 219 9.0E-07
sp|B7IH68|SURE_THEAB 5'-nucleotidase SurE OS=Thermosipho africanus (strain TCF52B) GN=surE PE=3 SV=1 23 219 9.0E-07
sp|Q2FLE8|SURE_METHJ 5'-nucleotidase SurE OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=surE PE=3 SV=1 98 219 1.0E-06
sp|Q57DM1|SURE_BRUAB 5'-nucleotidase SurE OS=Brucella abortus biovar 1 (strain 9-941) GN=surE PE=3 SV=1 23 219 1.0E-06
sp|Q2YNM5|SURE_BRUA2 5'-nucleotidase SurE OS=Brucella abortus (strain 2308) GN=surE PE=3 SV=1 23 219 1.0E-06
sp|B2S5B9|SURE_BRUA1 5'-nucleotidase SurE OS=Brucella abortus (strain S19) GN=surE PE=1 SV=1 23 219 1.0E-06
sp|B8CWH0|SURE_HALOH 5'-nucleotidase SurE OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=surE PE=3 SV=1 23 239 1.0E-06
sp|B9KDQ8|SURE_CAMLR 5'-nucleotidase SurE OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=surE PE=3 SV=1 125 222 1.0E-06
sp|A9IP06|SURE_BORPD 5'-nucleotidase SurE OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=surE PE=3 SV=1 24 220 2.0E-06
sp|B9M4Z4|SURE_GEODF 5'-nucleotidase SurE OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=surE PE=3 SV=1 24 219 2.0E-06
sp|Q0IC13|SURE_SYNS3 5'-nucleotidase SurE OS=Synechococcus sp. (strain CC9311) GN=surE PE=3 SV=1 24 238 2.0E-06
sp|A1K4E9|SURE_AZOSB 5'-nucleotidase SurE OS=Azoarcus sp. (strain BH72) GN=surE PE=3 SV=1 24 219 2.0E-06
sp|Q6FCV6|SURE_ACIAD 5'-nucleotidase SurE OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=surE PE=3 SV=1 23 223 2.0E-06
sp|A2SQ45|SURE_METLZ 5'-nucleotidase SurE OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=surE PE=3 SV=1 128 222 2.0E-06
sp|B9JXD7|SURE_AGRVS 5'-nucleotidase SurE OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=surE PE=3 SV=1 24 220 2.0E-06
sp|Q2JVR3|SURE_SYNJA 5'-nucleotidase SurE OS=Synechococcus sp. (strain JA-3-3Ab) GN=surE PE=3 SV=1 23 219 3.0E-06
sp|Q8KC69|SURE_CHLTE 5'-nucleotidase SurE OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=surE PE=3 SV=1 23 219 3.0E-06
sp|A0KU87|SURE_SHESA 5'-nucleotidase SurE OS=Shewanella sp. (strain ANA-3) GN=surE PE=3 SV=1 24 209 3.0E-06
sp|Q0C0W3|SURE_HYPNA 5'-nucleotidase SurE OS=Hyphomonas neptunium (strain ATCC 15444) GN=surE PE=3 SV=1 24 219 3.0E-06
sp|Q8YSE9|Y3139_NOSS1 Putative 5'-nucleotidase alr3139 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3139 PE=3 SV=1 24 222 3.0E-06
sp|Q47D24|SURE_DECAR 5'-nucleotidase SurE OS=Dechloromonas aromatica (strain RCB) GN=surE PE=3 SV=1 24 219 4.0E-06
sp|Q3A4N5|SURE_PELCD 5'-nucleotidase SurE OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=surE PE=3 SV=1 100 219 4.0E-06
sp|B1Y0T1|SURE_LEPCP 5'-nucleotidase SurE OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=surE PE=3 SV=1 24 246 4.0E-06
sp|A6VLU0|SURE_ACTSZ 5'-nucleotidase SurE OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=surE PE=3 SV=1 23 219 4.0E-06
sp|B0TAY4|SURE_HELMI 5'-nucleotidase SurE OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=surE PE=3 SV=1 102 220 4.0E-06
sp|B3EFW1|SURE_CHLL2 5'-nucleotidase SurE OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=surE PE=3 SV=1 23 219 4.0E-06
sp|Q7V0I6|SURE_PROMP 5'-nucleotidase SurE OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=surE PE=3 SV=1 23 225 4.0E-06
sp|Q2S1H7|SURE_SALRD 5'-nucleotidase SurE OS=Salinibacter ruber (strain DSM 13855 / M31) GN=surE PE=3 SV=1 24 233 5.0E-06
sp|Q74CZ6|SURE_GEOSL 5'-nucleotidase SurE OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=surE PE=3 SV=1 23 223 5.0E-06
sp|Q7W670|SURE_BORPA 5'-nucleotidase SurE OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=surE PE=3 SV=1 24 222 5.0E-06
sp|Q7WI36|SURE_BORBR 5'-nucleotidase SurE OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=surE PE=3 SV=1 24 222 5.0E-06
sp|Q2GG44|SURE_EHRCR 5'-nucleotidase SurE OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=surE PE=3 SV=1 24 223 6.0E-06
sp|Q8PLR4|SURE_XANAC 5'-nucleotidase SurE OS=Xanthomonas axonopodis pv. citri (strain 306) GN=surE PE=3 SV=1 24 220 7.0E-06
sp|A2BLQ8|SURE_HYPBU 5'-nucleotidase SurE OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=surE PE=3 SV=1 22 234 8.0E-06
sp|Q7V8I0|SURE_PROMM 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9313) GN=surE PE=3 SV=1 23 168 8.0E-06
sp|Q21UQ9|SURE_RHOFT 5'-nucleotidase SurE OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=surE PE=3 SV=1 24 220 8.0E-06
sp|A6SZY0|SURE_JANMA 5'-nucleotidase SurE OS=Janthinobacterium sp. (strain Marseille) GN=surE PE=3 SV=1 100 219 9.0E-06
sp|Q7VXN2|SURE_BORPE 5'-nucleotidase SurE OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=surE PE=3 SV=1 24 222 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5088
MFFPVAFILTALMALVSTSIAANIIQSNDDGWAELYLRTLNTALVASSHRVLLSAPAENKSGTSSRDKEPKARSK
ACQYSSCPEDTNARWGVNTTTGTEFWVNAYPATSVRYAIDEFAPEVWGANVEPDMVITGPNVGANYWLGVPFSGT
VGAACHAVDRGIPAIAFSAYSGPNAPWNMAPIPDRALLYADLAANLTNRILESGKPYLPRGVFLNVNFPKYKAPC
TDAAKFKWVLTRIYPGLISPPDTETCGSTRLPTEREVIHSRRGCYVSISVGDASDKTTVDDQRQKVVLDKLSDML
SCF*
Coding >OphauG2|5088
ATGTTCTTCCCCGTGGCCTTCATCCTTACCGCCCTCATGGCCCTCGTCTCCACCTCCATCGCCGCCAACATCATC
CAATCCAACGACGACGGCTGGGCGGAGCTCTACCTCCGCACCCTCAATACAGCCCTCGTCGCCTCGTCTCATCGG
GTCCTCCTCTCTGCCCCTGCCGAAAACAAATCGGGCACGTCGTCGCGCGACAAGGAACCAAAGGCCCGCTCCAAG
GCTTGCCAGTACTCGTCATGCCCGGAAGATACAAACGCTCGCTGGGGCGTGAATACAACAACGGGCACCGAGTTT
TGGGTAAACGCTTATCCAGCCACCTCTGTGCGCTACGCCATCGACGAGTTTGCGCCAGAGGTTTGGGGCGCCAAC
GTTGAACCTGACATGGTGATTACAGGTCCCAACGTGGGCGCCAACTACTGGCTTGGCGTGCCCTTTTCTGGAACC
GTTGGAGCGGCTTGCCACGCGGTTGACAGAGGAATCCCGGCCATTGCCTTCTCGGCCTATTCGGGGCCAAATGCA
CCTTGGAACATGGCGCCCATTCCTGATCGCGCCCTACTCTACGCAGACTTGGCCGCTAACCTGACGAACCGCATT
CTTGAGTCGGGAAAGCCATATCTGCCGCGGGGCGTCTTCTTGAATGTCAACTTTCCCAAGTACAAGGCGCCATGT
ACAGATGCTGCGAAATTCAAATGGGTCCTGACACGCATATACCCAGGACTGATTTCGCCCCCGGATACGGAGACT
TGTGGCTCGACAAGACTACCTACTGAACGCGAAGTGATTCATAGCCGCCGCGGTTGCTATGTCTCAATTAGCGTT
GGCGACGCGTCGGACAAGACTACTGTCGACGATCAACGCCAAAAGGTTGTCTTGGACAAGCTGAGCGACATGTTG
AGCTGTTTCTAA
Transcript >OphauG2|5088
ATGTTCTTCCCCGTGGCCTTCATCCTTACCGCCCTCATGGCCCTCGTCTCCACCTCCATCGCCGCCAACATCATC
CAATCCAACGACGACGGCTGGGCGGAGCTCTACCTCCGCACCCTCAATACAGCCCTCGTCGCCTCGTCTCATCGG
GTCCTCCTCTCTGCCCCTGCCGAAAACAAATCGGGCACGTCGTCGCGCGACAAGGAACCAAAGGCCCGCTCCAAG
GCTTGCCAGTACTCGTCATGCCCGGAAGATACAAACGCTCGCTGGGGCGTGAATACAACAACGGGCACCGAGTTT
TGGGTAAACGCTTATCCAGCCACCTCTGTGCGCTACGCCATCGACGAGTTTGCGCCAGAGGTTTGGGGCGCCAAC
GTTGAACCTGACATGGTGATTACAGGTCCCAACGTGGGCGCCAACTACTGGCTTGGCGTGCCCTTTTCTGGAACC
GTTGGAGCGGCTTGCCACGCGGTTGACAGAGGAATCCCGGCCATTGCCTTCTCGGCCTATTCGGGGCCAAATGCA
CCTTGGAACATGGCGCCCATTCCTGATCGCGCCCTACTCTACGCAGACTTGGCCGCTAACCTGACGAACCGCATT
CTTGAGTCGGGAAAGCCATATCTGCCGCGGGGCGTCTTCTTGAATGTCAACTTTCCCAAGTACAAGGCGCCATGT
ACAGATGCTGCGAAATTCAAATGGGTCCTGACACGCATATACCCAGGACTGATTTCGCCCCCGGATACGGAGACT
TGTGGCTCGACAAGACTACCTACTGAACGCGAAGTGATTCATAGCCGCCGCGGTTGCTATGTCTCAATTAGCGTT
GGCGACGCGTCGGACAAGACTACTGTCGACGATCAACGCCAAAAGGTTGTCTTGGACAAGCTGAGCGACATGTTG
AGCTGTTTCTAA
Gene >OphauG2|5088
ATGTTCTTCCCCGTGGCCTTCATCCTTACCGCCCTCATGGCCCTCGTCTCCACCTCCATCGCCGCCAACATCATC
CAATCCAACGACGACGGCTGGGCGGAGCTCTACCTCCGCACCCTCAATACAGCCCTCGTCGCCTCGTCTCATCGG
GTCCTCCTCTCTGCCCCTGCCGAAAACAAATCGGGCACGTCGTCGCGCGACAAGGAACCAAAGGCCCGCTCCAAG
GCTTGCCAGTACTCGTCATGCCCGGAAGATACAAACGCTCGCTGGGGCGTGAATACAACAACGGGCACCGAGTTT
TGGGTAAACGCTTATCCAGCCACCTCTGTGCGCTACGCCATCGACGAGTTTGCGCCAGAGGTTTGGGGCGCCAAC
GTTGAACCTGACATGGTGATTACAGGTCCCAACGTGGGCGCCAACTACTGGCTTGGCGTGCCCTTTTCTGGAACC
GTTGGAGCGGCTTGCCACGCGGTTGACAGAGGAATCCCGGCCATTGCCTTCTCGGCCTATTCGGGGCCAAATGCA
CCTTGGAACATGGCGCCCATTCCTGATCGCGCCCTACTCTACGCAGACTTGGCCGCTAACCTGACGAACCGCATT
CTTGAGTCGGGAAAGCCATATCTGCCGCGGGGCGTCTTCTTGAATGTCAACTTTCCCAAGTACAAGGCGCCATGT
ACAGATGCTGCGAAATTCAAATGGGTCCTGACACGCATATACCCAGGACTGATTTCGCCCCCGGATACGGAGACT
TGTGGCTCGACAAGACTACCTACTGAACGCGAAGTGATTCATAGCCGCCGCGGTTGCTATGTCTCAATTAGCGTT
GGCGACGCGTCGGACAAGACTACTGTCGACGATCAACGCCAAAAGGTTGTCTTGGACAAGCTGAGCGACATGTTG
AGCTGTTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail