Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5065
Gene name
LocationContig_45:3370..5618
Strand+
Gene length (bp)2248
Transcript length (bp)1968
Coding sequence length (bp)1968
Protein length (aa) 656

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18101 Pan3_PK Pan3 Pseudokinase domain 2.0E-60 508 645

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1E2S2|PAN3_COCIM PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Coccidioides immitis (strain RS) GN=PAN3 PE=3 SV=3 1 651 0.0E+00
sp|Q2H401|PAN3_CHAGB PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN3 PE=3 SV=2 1 650 0.0E+00
sp|Q0V0I4|PAN3_PHANO PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAN3 PE=3 SV=2 7 650 0.0E+00
sp|Q7SDP4|PAN3_NEUCR PAB-dependent poly(A)-specific ribonuclease subunit pan3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pan3 PE=1 SV=2 1 650 0.0E+00
sp|Q5BFB1|PAN3_EMENI PAB-dependent poly(A)-specific ribonuclease subunit pan3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pan3 PE=3 SV=3 1 651 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1E2S2|PAN3_COCIM PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Coccidioides immitis (strain RS) GN=PAN3 PE=3 SV=3 1 651 0.0E+00
sp|Q2H401|PAN3_CHAGB PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN3 PE=3 SV=2 1 650 0.0E+00
sp|Q0V0I4|PAN3_PHANO PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAN3 PE=3 SV=2 7 650 0.0E+00
sp|Q7SDP4|PAN3_NEUCR PAB-dependent poly(A)-specific ribonuclease subunit pan3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pan3 PE=1 SV=2 1 650 0.0E+00
sp|Q5BFB1|PAN3_EMENI PAB-dependent poly(A)-specific ribonuclease subunit pan3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pan3 PE=3 SV=3 1 651 0.0E+00
sp|A1D1Y5|PAN3_NEOFI PAB-dependent poly(A)-specific ribonuclease subunit pan3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pan3 PE=3 SV=2 1 651 0.0E+00
sp|Q2U0M4|PAN3_ASPOR PAB-dependent poly(A)-specific ribonuclease subunit pan3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pan3 PE=3 SV=2 1 651 0.0E+00
sp|Q0D0A1|PAN3_ASPTN PAB-dependent poly(A)-specific ribonuclease subunit pan3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pan3 PE=3 SV=2 8 651 0.0E+00
sp|Q6MY57|PAN3_ASPFU PAB-dependent poly(A)-specific ribonuclease subunit pan3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pan3 PE=3 SV=2 1 651 0.0E+00
sp|A1CP31|PAN3_ASPCL PAB-dependent poly(A)-specific ribonuclease subunit pan3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pan3 PE=3 SV=2 1 651 0.0E+00
sp|A2QAQ3|PAN3_ASPNC PAB-dependent poly(A)-specific ribonuclease subunit pan3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pan3 PE=3 SV=2 10 653 0.0E+00
sp|Q2KFH6|PAN3_MAGO7 PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN3 PE=3 SV=1 1 654 0.0E+00
sp|P0CP50|PAN3_CRYNJ PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAN3 PE=3 SV=1 20 653 4.0E-136
sp|P0CP51|PAN3_CRYNB PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAN3 PE=3 SV=1 20 653 4.0E-136
sp|A3LQL9|PAN3_PICST PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN3 PE=3 SV=2 26 647 2.0E-110
sp|Q6BRV5|PAN3_DEBHA PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN3 PE=3 SV=2 26 648 8.0E-109
sp|P0CD65|PAN3_DICDI PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Dictyostelium discoideum GN=pan3 PE=3 SV=1 227 645 3.0E-103
sp|Q6CBZ0|PAN3_YARLI PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAN3 PE=3 SV=1 209 646 2.0E-98
sp|A5DCP8|PAN3_PICGU PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAN3 PE=3 SV=2 26 648 3.0E-98
sp|A1L1C7|PAN3_XENTR PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Xenopus tropicalis GN=pan3 PE=2 SV=1 188 649 4.0E-92
sp|Q95RR8|PAN3_DROME PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Drosophila melanogaster GN=CG11486 PE=1 SV=1 235 649 2.0E-90
sp|Q640Q5|PAN3_MOUSE PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Mus musculus GN=Pan3 PE=1 SV=3 205 652 9.0E-90
sp|Q58A45|PAN3_HUMAN PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Homo sapiens GN=PAN3 PE=1 SV=3 212 649 1.0E-88
sp|Q5AK10|PAN3_CANAL PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAN3 PE=3 SV=1 26 642 3.0E-84
sp|Q75BU9|PAN3_ASHGO PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAN3 PE=3 SV=1 26 647 4.0E-83
sp|Q6CP23|PAN3_KLULA PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN3 PE=3 SV=1 26 647 3.0E-79
sp|P34653|PAN3_CAEEL PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Caenorhabditis elegans GN=panl-3 PE=1 SV=3 236 645 3.0E-72
sp|Q6FKP2|PAN3_CANGA PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAN3 PE=3 SV=1 26 645 2.0E-65
sp|P36102|PAN3_YEAST PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN3 PE=1 SV=1 26 647 1.0E-64
sp|Q9UST1|PAN3_SCHPO PAB-dependent poly(A)-specific ribonuclease subunit pan3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk26 PE=3 SV=1 26 642 4.0E-64
sp|O13865|PAN3L_SCHPO PAB-dependent poly(A)-specific ribonuclease subunit pan3-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B1.04c PE=1 SV=2 30 652 2.0E-53
sp|A5E2Y4|PAN3_LODEL PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN3 PE=3 SV=1 204 646 2.0E-52
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5065
MATSRFPSSDLRRQVGSPRPKGKENKETLCRNVLIYGHCRYEDQGCTFSHERHKSNNHSNNTNSPDVNKKSLNVE
SPSFTPASIQPSNLKKASLPTQAASAPAFTPSAGAGGVFLLSGTLTPTPVDSEVTNFNPAAIREFTPSFDTSSHI
TANGSSHDGSLPYDAFTMAAVGQSLPTTSFNPYADDHATLGTNSSYFPPQSQFAAPLQPLQHHLYAPAGPRKEDL
LPYQRTTHDFFISEKLRQEMVKKSEAALQVMPNSQLPQLDNYHSLVALDTTHRKNASIFGYPSWVYKAISSKSGH
IYSLRRLEGFRLTNEHAIRSVKEWRKINNANVVTTHDAFTVRAFGDSSLVFVQDYHPLSKTLAETHLSTIPGQGN
RFHIKVSVSEATLWGYISQIANALQAIHSNNLAARCVDVSKILLTNRNHIRLNACAVLDVVQFEMKRPLQELQQD
DLLQFGRTLLCLATNTLPAHLTNLNASVDQMSRSYSAEMRDTIVWLLSPPQSSTPKTIDEFVRGIAGHIVTTLDQ
SLHLADELNGVLFRELENGRIARILMKLGTVNERQEFDGDRAWSENGERYMLKLFRDYVFHQVDSNGNPVLDIGH
MVGCLNRLDIGADDRICLTSRDEQTSFLVSYRELKKQLSNAFNELQKASKQNRGL*
Coding >OphauG2|5065
ATGGCAACCTCGCGTTTTCCCTCGTCTGATCTTCGACGCCAGGTCGGCTCGCCGAGGCCCAAAGGCAAAGAGAAC
AAGGAGACGCTTTGTCGCAACGTGCTTATCTACGGGCATTGCCGTTACGAGGACCAAGGCTGTACCTTTTCCCAT
GAAAGACATAAATCGAATAACCACAGCAACAATACCAATTCCCCCGACGTCAACAAAAAGTCTCTCAATGTCGAG
TCTCCTTCTTTTACACCGGCCAGCATTCAGCCTAGTAACCTCAAGAAGGCTTCTCTCCCAACTCAGGCTGCCAGT
GCTCCAGCCTTTACCCCAAGCGCAGGCGCAGGAGGTGTTTTTCTCCTTTCAGGGACCTTGACCCCAACTCCTGTC
GATTCCGAAGTTACCAACTTCAATCCAGCTGCCATTCGCGAATTCACTCCCAGTTTTGATACTAGCTCTCATATC
ACTGCAAATGGTTCTTCTCATGATGGCTCGTTGCCTTACGACGCCTTTACAATGGCTGCCGTGGGCCAAAGTCTG
CCAACAACCTCGTTTAACCCATATGCAGACGACCACGCCACATTGGGCACCAATTCTTCATATTTTCCACCTCAG
AGCCAGTTTGCTGCACCGCTTCAGCCTCTTCAACATCACCTCTATGCGCCCGCTGGCCCTCGAAAGGAAGATCTT
TTACCATATCAGCGGACAACACATGACTTTTTTATTTCTGAAAAGTTGCGGCAGGAAATGGTCAAAAAGTCTGAG
GCTGCACTACAAGTAATGCCTAATTCACAACTGCCTCAGCTGGATAACTATCATTCCCTCGTCGCGCTCGATACA
ACTCATCGAAAAAACGCGAGCATTTTTGGCTATCCCAGCTGGGTCTACAAGGCCATTTCGTCCAAGAGCGGTCAC
ATTTACTCTCTACGACGGCTCGAAGGCTTTCGGCTTACCAACGAACATGCCATACGATCGGTAAAAGAATGGCGC
AAGATCAACAATGCAAACGTGGTAACTACGCACGATGCCTTCACCGTCCGCGCCTTTGGTGACAGCTCACTTGTA
TTTGTTCAAGACTATCATCCACTTTCCAAAACACTTGCTGAGACACATCTTTCCACGATTCCTGGCCAGGGAAAT
CGTTTCCACATCAAAGTTTCAGTATCAGAAGCGACTCTTTGGGGCTACATCTCTCAAATAGCCAACGCACTTCAA
GCAATTCACTCCAACAATTTGGCGGCTCGCTGTGTTGATGTCAGCAAAATTCTCTTGACAAATAGAAATCACATT
CGGCTCAACGCGTGTGCCGTTCTCGACGTGGTCCAATTCGAAATGAAGCGGCCTTTGCAAGAATTACAACAGGAC
GACTTGTTGCAATTTGGCCGCACGCTTCTATGCTTGGCAACAAACACACTGCCTGCCCATCTTACCAATCTCAAT
GCTTCAGTCGACCAGATGAGCCGTTCATACTCGGCAGAGATGCGTGATACTATTGTTTGGCTTCTGAGCCCCCCT
CAATCTTCAACACCCAAGACGATAGACGAATTTGTGCGGGGAATTGCTGGCCATATTGTGACCACACTTGACCAA
AGCTTGCATTTGGCCGACGAGCTCAATGGTGTTCTTTTCCGAGAGCTGGAAAACGGTAGAATCGCCCGGATACTA
ATGAAGCTTGGGACAGTCAATGAACGTCAAGAATTTGACGGAGATCGAGCTTGGTCGGAAAATGGGGAGCGATAT
ATGCTCAAGCTCTTCCGTGATTATGTCTTTCATCAGGTTGATAGCAATGGCAACCCAGTACTGGATATAGGGCAT
ATGGTTGGCTGCTTGAATCGCCTCGATATTGGTGCAGACGACAGAATCTGCCTCACTAGCCGCGACGAACAGACC
AGCTTCCTTGTCAGTTATAGGGAACTGAAGAAGCAGCTGAGCAACGCATTCAACGAACTTCAAAAGGCGAGCAAG
CAAAACAGGGGACTTTAG
Transcript >OphauG2|5065
ATGGCAACCTCGCGTTTTCCCTCGTCTGATCTTCGACGCCAGGTCGGCTCGCCGAGGCCCAAAGGCAAAGAGAAC
AAGGAGACGCTTTGTCGCAACGTGCTTATCTACGGGCATTGCCGTTACGAGGACCAAGGCTGTACCTTTTCCCAT
GAAAGACATAAATCGAATAACCACAGCAACAATACCAATTCCCCCGACGTCAACAAAAAGTCTCTCAATGTCGAG
TCTCCTTCTTTTACACCGGCCAGCATTCAGCCTAGTAACCTCAAGAAGGCTTCTCTCCCAACTCAGGCTGCCAGT
GCTCCAGCCTTTACCCCAAGCGCAGGCGCAGGAGGTGTTTTTCTCCTTTCAGGGACCTTGACCCCAACTCCTGTC
GATTCCGAAGTTACCAACTTCAATCCAGCTGCCATTCGCGAATTCACTCCCAGTTTTGATACTAGCTCTCATATC
ACTGCAAATGGTTCTTCTCATGATGGCTCGTTGCCTTACGACGCCTTTACAATGGCTGCCGTGGGCCAAAGTCTG
CCAACAACCTCGTTTAACCCATATGCAGACGACCACGCCACATTGGGCACCAATTCTTCATATTTTCCACCTCAG
AGCCAGTTTGCTGCACCGCTTCAGCCTCTTCAACATCACCTCTATGCGCCCGCTGGCCCTCGAAAGGAAGATCTT
TTACCATATCAGCGGACAACACATGACTTTTTTATTTCTGAAAAGTTGCGGCAGGAAATGGTCAAAAAGTCTGAG
GCTGCACTACAAGTAATGCCTAATTCACAACTGCCTCAGCTGGATAACTATCATTCCCTCGTCGCGCTCGATACA
ACTCATCGAAAAAACGCGAGCATTTTTGGCTATCCCAGCTGGGTCTACAAGGCCATTTCGTCCAAGAGCGGTCAC
ATTTACTCTCTACGACGGCTCGAAGGCTTTCGGCTTACCAACGAACATGCCATACGATCGGTAAAAGAATGGCGC
AAGATCAACAATGCAAACGTGGTAACTACGCACGATGCCTTCACCGTCCGCGCCTTTGGTGACAGCTCACTTGTA
TTTGTTCAAGACTATCATCCACTTTCCAAAACACTTGCTGAGACACATCTTTCCACGATTCCTGGCCAGGGAAAT
CGTTTCCACATCAAAGTTTCAGTATCAGAAGCGACTCTTTGGGGCTACATCTCTCAAATAGCCAACGCACTTCAA
GCAATTCACTCCAACAATTTGGCGGCTCGCTGTGTTGATGTCAGCAAAATTCTCTTGACAAATAGAAATCACATT
CGGCTCAACGCGTGTGCCGTTCTCGACGTGGTCCAATTCGAAATGAAGCGGCCTTTGCAAGAATTACAACAGGAC
GACTTGTTGCAATTTGGCCGCACGCTTCTATGCTTGGCAACAAACACACTGCCTGCCCATCTTACCAATCTCAAT
GCTTCAGTCGACCAGATGAGCCGTTCATACTCGGCAGAGATGCGTGATACTATTGTTTGGCTTCTGAGCCCCCCT
CAATCTTCAACACCCAAGACGATAGACGAATTTGTGCGGGGAATTGCTGGCCATATTGTGACCACACTTGACCAA
AGCTTGCATTTGGCCGACGAGCTCAATGGTGTTCTTTTCCGAGAGCTGGAAAACGGTAGAATCGCCCGGATACTA
ATGAAGCTTGGGACAGTCAATGAACGTCAAGAATTTGACGGAGATCGAGCTTGGTCGGAAAATGGGGAGCGATAT
ATGCTCAAGCTCTTCCGTGATTATGTCTTTCATCAGGTTGATAGCAATGGCAACCCAGTACTGGATATAGGGCAT
ATGGTTGGCTGCTTGAATCGCCTCGATATTGGTGCAGACGACAGAATCTGCCTCACTAGCCGCGACGAACAGACC
AGCTTCCTTGTCAGTTATAGGGAACTGAAGAAGCAGCTGAGCAACGCATTCAACGAACTTCAAAAGGCGAGCAAG
CAAAACAGGGGACTTTAG
Gene >OphauG2|5065
ATGGCAACCTCGCGTTTTCCCTCGTCTGATCTTCGACGCCAGGTCGGCTCGCCGAGGCCCAAAGGCAAAGGTGAC
TTGTGCCCCAACTCCCCAATTTCACCTCGCTTACCCCATTGCAGAGAACAAGGAGACGCTTTGTCGCAACGTGCT
TATCTACGGGCATTGCCGTTACGAGGACCAAGGCTGTACCTTTTCCCATGAAAGACATAAATCGAATAACCACAG
CAACAATACCAATTCCCCCGACGTGTACGTTCTGCTTGACACCTTGTTGGCCCACCTCGACACGTACCTCCAACT
TTGCCCCTAAATTCCTTTGCCAGCCTGCCCAACCAAGTTGTCCTCACTAACATTTCTCTAATTCCAGCAACAAAA
AGTCTCTCAATGTCGAGTCTCCTTCTTTTACACCGGCCAGCATTCAGCCTAGTAACCTCAAGAAGGCTTCTCTCC
CAACTCAGGCTGCCAGTGCTCCAGCCTTTACCCCAAGCGCAGGCGCAGGAGGTCAATTCACTCCCAGACTTCACC
AGCCATCGCAAAGCAGCGCTGACTCGTCTCATCACAGGTGTTTTTCTCCTTTCAGGGACCTTGACCCCAACTCCT
GTCGATTCCGAAGTTACCAACTTCAATCCAGCTGCCATTCGCGAATTCACTCCCAGTTTTGATACTAGCTCTCAT
GTGAGTTTCTCTCAAACTCTCGTGCCGCGCTTTATTCTGACCCAGATTCAAGATCACTGCAAATGGTTCTTCTCA
TGATGGCTCGTTGCCTTACGACGCCTTTACAATGGCTGCCGTGGGCCAAAGTCTGCCAACAACCTCGTTTAACCC
ATATGCAGACGACCACGCCACATTGGGCACCAATTCTTCATATTTTCCACCTCAGAGCCAGTTTGCTGCACCGCT
TCAGCCTCTTCAACATCACCTCTATGCGCCCGCTGGCCCTCGAAAGGAAGATCTTTTACCATATCAGCGGACAAC
ACATGACTTTTTTATTTCTGAAAAGTTGCGGCAGGAAATGGTCAAAAAGTCTGAGGCTGCACTACAAGTAATGCC
TAATTCACAACTGCCTCAGCTGGATAACTATCATTCCCTCGTCGCGCTCGATACAACTCATCGAAAAAACGCGAG
CATTTTTGGCTATCCCAGCTGGGTCTACAAGGCCATTTCGTCCAAGAGCGGTCACATTTACTCTCTACGACGGCT
CGAAGGCTTTCGGCTTACCAACGAACATGCCATACGATCGGTAAAAGAATGGCGCAAGATCAACAATGCAAACGT
GGTAACTACGCACGATGCCTTCACCGTCCGCGCCTTTGGTGACAGCTCACTTGTATTTGTTCAAGACTATCATCC
ACTTTCCAAAACACTTGCTGAGACACATCTTTCCACGATTCCTGGCCAGGGAAATCGTTTCCACATCAAAGTTTC
AGTATCAGAAGCGACTCTTTGGGGCTACATCTCTCAAATAGCCAACGCACTTCAAGCAATTCACTCCAACAATTT
GGCGGCTCGCTGTGTTGATGTCAGCAAAATTCTCTTGACAAATAGAAATCACATTCGGCTCAACGCGTGTGCCGT
TCTCGACGTGGTCCAATTCGAAATGAAGCGGCCTTTGCAAGAATTACAACAGGACGACTTGTTGCAATTTGGCCG
CACGCTTCTATGCTTGGCAACAAACACACTGCCTGCCCATCTTACCAATCTCAATGCTTCAGTCGACCAGATGAG
CCGTTCATACTCGGCAGAGATGCGTGATACTATTGTTTGGCTTCTGAGCCCCCCTCAATCTTCAACACCCAAGAC
GATAGACGAATTTGTGCGGGGAATTGCTGGCCATATTGTGACCACACTTGACCAAAGCTTGCATTTGGCCGACGA
GCTCAATGGTGTTCTTTTCCGAGAGCTGGAAAACGGTAGAATCGCCCGGATACTAATGAAGCTTGGGACAGTCAA
TGAACGTCAAGAATTTGACGGAGATCGAGCTTGGTCGGAAAATGGGGAGCGATATATGCTCAAGCTCTTCCGTGA
TTATGTCTTTCATCAGGTTGATAGCAATGGCAACCCAGTACTGGATATAGGGCATATGGTTGGCTGCTTGAATCG
CCTCGATATTGGTGCAGACGACAGAATCTGCCTCACTAGCCGCGACGAACAGACCAGCTTCCTTGTCAGTTATAG
GGAACTGAAGAAGCAGCTGAGCAACGCATTCAACGAACTTCAAAAGGCGAGCAAGCAAAACAGGGGACTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail