Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5064
Gene name
LocationContig_45:621..2249
Strand-
Gene length (bp)1628
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14555 UBA_4 UBA-like domain 7.3E-11 17 57
PF00789 UBX UBX domain 1.2E-07 403 504

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74498|UCP10_SCHPO UBX domain-containing protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp10 PE=3 SV=1 164 503 2.0E-44
sp|Q6GQ69|FAF2B_XENLA FAS-associated factor 2-B OS=Xenopus laevis GN=faf2-b PE=2 SV=1 12 481 8.0E-27
sp|Q12229|UBX3_YEAST UBX domain-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX3 PE=1 SV=1 176 503 1.0E-26
sp|Q28BP9|FAF2_XENTR FAS-associated factor 2 OS=Xenopus tropicalis GN=faf2 PE=2 SV=1 11 481 3.0E-25
sp|Q96CS3|FAF2_HUMAN FAS-associated factor 2 OS=Homo sapiens GN=FAF2 PE=1 SV=2 11 481 6.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74498|UCP10_SCHPO UBX domain-containing protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp10 PE=3 SV=1 164 503 2.0E-44
sp|Q6GQ69|FAF2B_XENLA FAS-associated factor 2-B OS=Xenopus laevis GN=faf2-b PE=2 SV=1 12 481 8.0E-27
sp|Q12229|UBX3_YEAST UBX domain-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX3 PE=1 SV=1 176 503 1.0E-26
sp|Q28BP9|FAF2_XENTR FAS-associated factor 2 OS=Xenopus tropicalis GN=faf2 PE=2 SV=1 11 481 3.0E-25
sp|Q96CS3|FAF2_HUMAN FAS-associated factor 2 OS=Homo sapiens GN=FAF2 PE=1 SV=2 11 481 6.0E-24
sp|Q6AZH6|FAF2A_XENLA FAS-associated factor 2-A OS=Xenopus laevis GN=faf2-a PE=2 SV=1 11 481 7.0E-24
sp|Q3TDN2|FAF2_MOUSE FAS-associated factor 2 OS=Mus musculus GN=Faf2 PE=1 SV=2 11 481 6.0E-23
sp|Q2HJD0|FAF2_BOVIN FAS-associated factor 2 OS=Bos taurus GN=FAF2 PE=2 SV=1 11 481 8.0E-23
sp|Q9M0N1|PUX10_ARATH Plant UBX domain-containing protein 10 OS=Arabidopsis thaliana GN=PUX10 PE=2 SV=1 18 440 2.0E-20
sp|Q5BK32|FAF2_RAT FAS-associated factor 2 OS=Rattus norvegicus GN=Faf2 PE=2 SV=1 121 481 2.0E-19
sp|Q04228|UBX2_YEAST UBX domain-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX2 PE=1 SV=1 11 453 7.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1939
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5064 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2100
Ophiocordyceps camponoti-floridani Ophcf2|03031
Ophiocordyceps camponoti-rufipedis Ophun1|316
Ophiocordyceps kimflemingae Ophio5|6133
Ophiocordyceps subramaniannii Hirsu2|2076

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5064
MADDAPGGAGELSRSQQDALQQYIQVTQQDAADAIALLQRSQWNVQIAIAKFFDGEGPDLVAEATAAQSVPYTSP
YHDNLQESLMATADRSWHRPRTEAAPRVVPQQSVTRRPPWLLGLILVPFGWGCRVASSLFRTICYLLSFLPAPLR
PRSVVAGPRSPRGRRMLVPRDTAARFKREFDEEYGPNDLSLFEGGLAQAYDLAKKDVKFLLVLLLSPEHDDTPHF
VRDTLLAPDVVEFINNPVNNIIIWGGTVLDSEAYQASVEYNCTKFPFTALVCLTPKDGGGTWMAIVKRLAGPMPP
ATYISELQGAMDRYGGELEVVRAERAAQEMARNIRTEQDSAYERSLAIDRKRTMEKKEAAAAAAEAERRRRQENE
ALEVLQAKRAQWIAWRANKIIPEPRADDKNVVRVALKMPEAMQTGRIVRRFPPQASVEELYAFVDCYEQLGQSSE
AAEAGESKIEKPDDYQHKYKFRIASTLPRRVHEPSTTATLRETIGKSANLIVEEASSEEDEEEASSVGAD*
Coding >OphauG2|5064
ATGGCTGATGATGCCCCTGGTGGTGCTGGCGAGCTGTCTCGGTCCCAGCAAGACGCGCTGCAGCAATATATCCAG
GTCACGCAGCAAGACGCGGCCGACGCCATAGCACTACTACAGCGATCGCAGTGGAACGTCCAGATTGCCATTGCC
AAGTTTTTCGATGGCGAAGGGCCAGATCTCGTGGCCGAGGCGACGGCAGCTCAGAGCGTCCCATACACCTCGCCA
TACCACGACAATCTCCAGGAAAGCCTCATGGCCACGGCTGACCGCTCATGGCACCGCCCCCGCACCGAAGCTGCG
CCCAGAGTGGTCCCACAGCAATCCGTCACCCGCCGCCCACCTTGGCTGCTCGGCCTGATTCTTGTGCCCTTTGGA
TGGGGCTGTCGTGTGGCCTCGAGTCTCTTCCGCACCATCTGCTACCTTTTGTCATTCCTGCCCGCTCCTTTACGT
CCGCGATCTGTCGTTGCCGGCCCCAGGAGCCCCCGAGGCCGTCGCATGCTAGTACCACGAGACACTGCAGCTCGC
TTCAAGCGTGAATTTGACGAGGAATATGGCCCCAACGACTTGTCCTTATTTGAAGGTGGACTAGCCCAGGCATAC
GACTTGGCCAAAAAGGACGTCAAGTTTCTCCTCGTTCTGCTCTTGTCACCCGAACATGACGACACTCCGCACTTT
GTTCGAGATACTCTACTTGCCCCTGACGTGGTCGAGTTTATCAATAACCCTGTAAACAATATCATCATCTGGGGA
GGAACTGTCTTGGACTCTGAGGCATACCAAGCGTCTGTCGAGTACAACTGTACCAAGTTCCCCTTTACTGCTCTG
GTATGCTTAACACCAAAGGACGGTGGAGGCACGTGGATGGCTATAGTGAAGCGGCTAGCAGGCCCAATGCCGCCA
GCGACGTATATATCAGAGCTTCAGGGCGCCATGGATCGGTATGGAGGCGAATTGGAGGTTGTACGAGCCGAACGA
GCAGCGCAAGAGATGGCACGCAATATTCGAACCGAGCAAGACTCGGCATATGAAAGATCACTAGCTATCGACAGG
AAGCGTACCATGGAGAAGAAAGAGGCTGCCGCTGCCGCTGCCGAGGCGGAACGACGAAGACGCCAAGAGAACGAA
GCACTCGAGGTGCTACAAGCGAAGCGTGCACAGTGGATAGCATGGCGAGCCAACAAGATAATACCTGAGCCCCGT
GCTGACGACAAGAATGTTGTTCGCGTTGCTCTCAAGATGCCAGAAGCGATGCAAACAGGCCGCATCGTTCGGCGC
TTTCCACCACAGGCGTCAGTTGAAGAACTCTACGCGTTCGTCGACTGCTACGAACAGCTTGGGCAATCAAGCGAG
GCGGCAGAGGCAGGCGAGAGCAAGATTGAGAAACCTGACGACTACCAACATAAATACAAGTTTAGAATAGCATCG
ACGTTACCACGGCGGGTGCACGAGCCGAGCACGACAGCAACACTGCGAGAGACGATTGGCAAGTCGGCCAATCTC
ATAGTCGAAGAGGCATCTTCTGAAGAGGATGAAGAGGAGGCAAGCAGCGTTGGCGCAGACTAG
Transcript >OphauG2|5064
ATGGCTGATGATGCCCCTGGTGGTGCTGGCGAGCTGTCTCGGTCCCAGCAAGACGCGCTGCAGCAATATATCCAG
GTCACGCAGCAAGACGCGGCCGACGCCATAGCACTACTACAGCGATCGCAGTGGAACGTCCAGATTGCCATTGCC
AAGTTTTTCGATGGCGAAGGGCCAGATCTCGTGGCCGAGGCGACGGCAGCTCAGAGCGTCCCATACACCTCGCCA
TACCACGACAATCTCCAGGAAAGCCTCATGGCCACGGCTGACCGCTCATGGCACCGCCCCCGCACCGAAGCTGCG
CCCAGAGTGGTCCCACAGCAATCCGTCACCCGCCGCCCACCTTGGCTGCTCGGCCTGATTCTTGTGCCCTTTGGA
TGGGGCTGTCGTGTGGCCTCGAGTCTCTTCCGCACCATCTGCTACCTTTTGTCATTCCTGCCCGCTCCTTTACGT
CCGCGATCTGTCGTTGCCGGCCCCAGGAGCCCCCGAGGCCGTCGCATGCTAGTACCACGAGACACTGCAGCTCGC
TTCAAGCGTGAATTTGACGAGGAATATGGCCCCAACGACTTGTCCTTATTTGAAGGTGGACTAGCCCAGGCATAC
GACTTGGCCAAAAAGGACGTCAAGTTTCTCCTCGTTCTGCTCTTGTCACCCGAACATGACGACACTCCGCACTTT
GTTCGAGATACTCTACTTGCCCCTGACGTGGTCGAGTTTATCAATAACCCTGTAAACAATATCATCATCTGGGGA
GGAACTGTCTTGGACTCTGAGGCATACCAAGCGTCTGTCGAGTACAACTGTACCAAGTTCCCCTTTACTGCTCTG
GTATGCTTAACACCAAAGGACGGTGGAGGCACGTGGATGGCTATAGTGAAGCGGCTAGCAGGCCCAATGCCGCCA
GCGACGTATATATCAGAGCTTCAGGGCGCCATGGATCGGTATGGAGGCGAATTGGAGGTTGTACGAGCCGAACGA
GCAGCGCAAGAGATGGCACGCAATATTCGAACCGAGCAAGACTCGGCATATGAAAGATCACTAGCTATCGACAGG
AAGCGTACCATGGAGAAGAAAGAGGCTGCCGCTGCCGCTGCCGAGGCGGAACGACGAAGACGCCAAGAGAACGAA
GCACTCGAGGTGCTACAAGCGAAGCGTGCACAGTGGATAGCATGGCGAGCCAACAAGATAATACCTGAGCCCCGT
GCTGACGACAAGAATGTTGTTCGCGTTGCTCTCAAGATGCCAGAAGCGATGCAAACAGGCCGCATCGTTCGGCGC
TTTCCACCACAGGCGTCAGTTGAAGAACTCTACGCGTTCGTCGACTGCTACGAACAGCTTGGGCAATCAAGCGAG
GCGGCAGAGGCAGGCGAGAGCAAGATTGAGAAACCTGACGACTACCAACATAAATACAAGTTTAGAATAGCATCG
ACGTTACCACGGCGGGTGCACGAGCCGAGCACGACAGCAACACTGCGAGAGACGATTGGCAAGTCGGCCAATCTC
ATAGTCGAAGAGGCATCTTCTGAAGAGGATGAAGAGGAGGCAAGCAGCGTTGGCGCAGACTAG
Gene >OphauG2|5064
ATGGCTGATGATGCCCCTGGTGGTGCTGGCGAGCTGTCTCGGTCCCAGCAAGACGCGCTGCAGCAATATATCCAG
GTCACGCAGCAAGACGCGGCCGACGCCATAGCACTACTACAGCGATCGCAGTGGAACGTCCAGGTCAGCGATCAA
TGTCGGCTGCGGCAGCAGTCTCGCGCTTGGCTGACTCGAGCTTGTCCTTGCAGATTGCCATTGCCAAGTTTTTCG
ATGGCGAAGGGCCAGATCTCGTGGCCGAGGCGACGGCAGCTCAGAGCGTCCCATACACCTCGCCATACCACGACA
ATCTCCAGGAAAGCCTCATGGCCACGGCTGACCGCTCATGGCACCGCCCCCGCACCGAAGCTGCGCCCAGAGTGG
TCCCACAGCAATCCGTCACCCGCCGCCCACCTTGGCTGCTCGGCCTGATTCTTGTGCCCTTTGGATGGGGCTGTC
GTGTGGCCTCGAGTCTCTTCCGCACCATCTGCTACCTTTTGTCATTCCTGCCCGCTCCTTTACGTCCGCGATCTG
TCGTTGCCGGCCCCAGGAGCCCCCGAGGCCGTCGCATGCTAGTACCACGAGACACTGCAGCTCGCTTCAAGCGTG
AATTTGACGAGGAATATGGCCCCAACGACTTGTCCTTATTTGAAGGTGGACTAGCCCAGGCATACGACTTGGCCA
AAAAGGACGTCAAGTTTCTCCTCGTTCTGCTCTTGTCACCCGAACATGACGACACTCCGCACTTTGTTCGAGATA
CTCTACTTGCCCCTGACGTGGTCGAGTTTATCAATAACCCTGTAAACAATATCATCATCTGGGGAGGAACTGTCT
TGGACTCTGAGGCATACCAAGCGTCTGTCGAGTACAACTGTACCAAGTTCCCCTTTACTGCTCTGGTATGCTTAA
CACCAAAGGACGGTGGAGGCACGTGGATGGCTATAGTGAAGCGGCTAGCAGGCCCAATGCCGCCAGCGACGTATA
TATCAGAGCTTCAGGGCGCCATGGATCGGTATGGAGGCGAATTGGAGGTTGTACGAGCCGAACGAGCAGCGCAAG
AGATGGCACGCAATATTCGAACCGAGCAAGACTCGGCATATGAAAGATCACTAGCTATCGACAGGAAGCGTACCA
TGGAGAAGAAAGAGGCTGCCGCTGCCGCTGCCGAGGCGGAACGACGAAGACGCCAAGAGAACGAAGCACTCGAGG
TGCTACAAGCGAAGCGTGCACAGTGGATAGCATGGCGAGCCAACAAGATAATACCTGAGCCCCGTGCTGACGACA
AGAATGTTGTTCGCGTTGCTCTCAAGATGCCAGAAGCGATGCAAACAGGCCGCATCGTTCGGCGCTTTCCACCAC
AGGCGTCAGTTGAAGAACTCTACGCGTTCGTCGACTGCTACGAACAGCTTGGGCAATCAAGCGAGGCGGCAGAGG
CAGGCGAGAGCAAGATTGAGAAACCTGACGACTACCAACATAAATACAAGTTTAGAATAGCATCGACGTTACCAC
GGCGGGTGCACGAGCCGAGCACGACAGCAACACTGCGAGAGACGATTGGCAAGTCGGCCAATCTCATAGTCGAAG
AGGCATCTTCTGAAGAGGATGAAGAGGAGGCAAGCAGCGTTGGCGCAGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail