Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|506
Gene name
LocationContig_1116:3665..5337
Strand-
Gene length (bp)1672
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.8E-14 66 429
PF00083 Sugar_tr Sugar (and other) transporter 2.7E-16 100 507

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 25 519 0.0E+00
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 44 520 3.0E-27
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 47 517 1.0E-22
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 47 517 3.0E-22
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 47 517 4.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 25 519 0.0E+00
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 44 520 3.0E-27
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 47 517 1.0E-22
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 47 517 3.0E-22
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 47 517 4.0E-22
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 47 517 4.0E-22
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 55 518 5.0E-21
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 47 517 6.0E-21
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 47 517 1.0E-20
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 108 517 3.0E-16
sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 100 517 3.0E-15
sp|O77504|S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus GN=SLC22A1 PE=1 SV=1 100 516 3.0E-15
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 71 511 3.0E-15
sp|Q4U2R8|S22A6_HUMAN Solute carrier family 22 member 6 OS=Homo sapiens GN=SLC22A6 PE=1 SV=1 71 511 3.0E-15
sp|O35956|S22A6_RAT Solute carrier family 22 member 6 OS=Rattus norvegicus GN=Slc22a6 PE=1 SV=1 71 517 4.0E-15
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 108 517 2.0E-14
sp|Q4W8A3|S22A6_MACFA Solute carrier family 22 member 6 OS=Macaca fascicularis GN=SLC22A6 PE=1 SV=1 71 511 2.0E-14
sp|Q5RCH6|S22A6_PONAB Solute carrier family 22 member 6 OS=Pongo abelii GN=SLC22A6 PE=2 SV=1 71 511 2.0E-14
sp|Q864Z3|S22A6_BOVIN Solute carrier family 22 member 6 OS=Bos taurus GN=SLC22A6 PE=2 SV=2 71 511 3.0E-14
sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2 100 516 5.0E-13
sp|Q9Z0E8|S22A5_MOUSE Solute carrier family 22 member 5 OS=Mus musculus GN=Slc22a5 PE=1 SV=1 97 516 5.0E-13
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 100 516 1.0E-12
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 42 312 2.0E-12
sp|Q9TSY7|S22A6_RABIT Solute carrier family 22 member 6 OS=Oryctolagus cuniculus GN=SLC22A6 PE=2 SV=1 71 511 2.0E-12
sp|Q1LVS8|SVOPL_DANRE Putative transporter SVOPL OS=Danio rerio GN=svopl PE=2 SV=1 37 517 2.0E-12
sp|O02713|S22A2_PIG Solute carrier family 22 member 2 OS=Sus scrofa GN=SLC22A2 PE=2 SV=1 100 517 4.0E-12
sp|Q9WTN6|S22AL_MOUSE Solute carrier family 22 member 21 OS=Mus musculus GN=Slc22a21 PE=2 SV=1 97 516 4.0E-12
sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 100 516 7.0E-12
sp|Q66J54|S226A_XENLA Solute carrier family 22 member 6-A OS=Xenopus laevis GN=slc22a6-a PE=2 SV=1 103 511 7.0E-12
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 61 481 1.0E-11
sp|Q8MK48|S22A6_PIG Solute carrier family 22 member 6 OS=Sus scrofa GN=SLC22A6 PE=1 SV=2 97 511 1.0E-11
sp|O70594|S22A5_RAT Solute carrier family 22 member 5 OS=Rattus norvegicus GN=Slc22a5 PE=1 SV=1 97 516 2.0E-11
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 42 312 3.0E-11
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 42 316 3.0E-11
sp|Q80UJ1|S22AK_MOUSE Solute carrier family 22 member 20 OS=Mus musculus GN=Slc22a20 PE=1 SV=1 100 515 3.0E-11
sp|Q7ZX53|S22FL_XENLA Solute carrier family 22 member 15-like OS=Xenopus laevis GN=slc22a15b PE=2 SV=1 86 517 3.0E-11
sp|Q66J52|S226B_XENLA Solute carrier family 22 member 6-B OS=Xenopus laevis GN=slc22a6-b PE=2 SV=1 103 511 4.0E-11
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 107 499 7.0E-11
sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1 108 498 1.0E-10
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 24 517 2.0E-10
sp|O70577|S22A2_MOUSE Solute carrier family 22 member 2 OS=Mus musculus GN=Slc22a2 PE=1 SV=1 100 297 2.0E-10
sp|O76082|S22A5_HUMAN Solute carrier family 22 member 5 OS=Homo sapiens GN=SLC22A5 PE=1 SV=1 107 516 3.0E-10
sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=1 SV=2 100 516 7.0E-10
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 108 499 8.0E-10
sp|Q5R5H7|S22A2_PONAB Solute carrier family 22 member 2 OS=Pongo abelii GN=SLC22A2 PE=2 SV=1 100 482 1.0E-09
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 108 499 1.0E-09
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 42 279 2.0E-09
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 108 499 2.0E-09
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 42 279 2.0E-09
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 42 279 2.0E-09
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 42 279 2.0E-09
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 108 499 2.0E-09
sp|Q9R0W2|S22A2_RAT Solute carrier family 22 member 2 OS=Rattus norvegicus GN=Slc22a2 PE=1 SV=1 100 482 2.0E-09
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 42 279 3.0E-09
sp|Q9WTW5|S22A3_MOUSE Solute carrier family 22 member 3 OS=Mus musculus GN=Slc22a3 PE=2 SV=1 106 516 4.0E-09
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 18 278 5.0E-09
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 107 517 5.0E-09
sp|O88446|S22A3_RAT Solute carrier family 22 member 3 OS=Rattus norvegicus GN=Slc22a3 PE=2 SV=1 106 516 5.0E-09
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 42 279 1.0E-08
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 18 278 1.0E-08
sp|O15244|S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo sapiens GN=SLC22A2 PE=1 SV=2 100 482 1.0E-08
sp|Q95R48|OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster GN=Orct2 PE=2 SV=2 107 511 1.0E-08
sp|Q28ES4|S22FL_XENTR Solute carrier family 22 member 15-like OS=Xenopus tropicalis GN=slc22a15b PE=2 SV=1 108 517 1.0E-08
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 18 278 2.0E-08
sp|Q504N2|S22AF_MOUSE Solute carrier family 22 member 15 OS=Mus musculus GN=Slc22a15 PE=2 SV=3 108 498 3.0E-08
sp|Q9R141|S22A4_RAT Solute carrier family 22 member 4 OS=Rattus norvegicus GN=Slc22a4 PE=1 SV=1 97 516 3.0E-08
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 102 501 3.0E-08
sp|Q6NUB3|S22AF_XENLA Solute carrier family 22 member 15 OS=Xenopus laevis GN=slc22a15 PE=2 SV=2 108 511 3.0E-08
sp|O75751|S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo sapiens GN=SLC22A3 PE=1 SV=1 106 516 1.0E-07
sp|Q17QN9|S22AG_BOVIN Solute carrier family 22 member 16 OS=Bos taurus GN=SLC22A16 PE=2 SV=2 254 511 1.0E-07
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 107 498 2.0E-07
sp|Q66KG0|S22AG_XENLA Solute carrier family 22 member 16 OS=Xenopus laevis GN=slc22a16 PE=2 SV=2 254 511 2.0E-07
sp|Q9Z306|S22A4_MOUSE Solute carrier family 22 member 4 OS=Mus musculus GN=Slc22a4 PE=1 SV=1 97 516 3.0E-07
sp|A6NK97|S22AK_HUMAN Solute carrier family 22 member 20 OS=Homo sapiens GN=SLC22A20 PE=2 SV=1 100 510 3.0E-07
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 38 477 3.0E-07
sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo sapiens GN=SLC22A4 PE=1 SV=3 97 516 6.0E-07
sp|Q5RLM2|S22A7_RAT Solute carrier family 22 member 7 OS=Rattus norvegicus GN=Slc22a7 PE=1 SV=1 107 517 9.0E-07
sp|O57379|S22A6_PSEAM Solute carrier family 22 member 6 OS=Pseudopleuronectes americanus GN=SLC22A6 PE=1 SV=1 108 511 1.0E-06
sp|Q70BM6|S22A8_PIG Solute carrier family 22 member 8 OS=Sus scrofa GN=SLC22A8 PE=2 SV=1 100 511 1.0E-06
sp|Q8CFZ5|S22AC_MOUSE Solute carrier family 22 member 12 OS=Mus musculus GN=Slc22a12 PE=1 SV=1 103 511 2.0E-06
sp|O88909|S22A8_MOUSE Solute carrier family 22 member 8 OS=Mus musculus GN=Slc22a8 PE=1 SV=2 228 504 4.0E-06
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 44 478 5.0E-06
sp|Q6NYN7|S22A6_DANRE Solute carrier family 22 member 6 OS=Danio rerio GN=slc22a6 PE=2 SV=1 108 511 5.0E-06
sp|Q863T6|S22A1_PIG Solute carrier family 22 member 1 OS=Sus scrofa GN=SLC22A1 PE=2 SV=1 237 516 6.0E-06
sp|Q63ZE4|S22AA_HUMAN Solute carrier family 22 member 10 OS=Homo sapiens GN=SLC22A10 PE=2 SV=2 108 511 8.0E-06
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 364 520 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 102 124 22
3 137 159 22
4 187 209 22
5 230 252 22
6 335 357 22
7 378 400 22
8 428 450 22
9 463 485 22
10 490 512 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|506
MGTDTALEGSEVSQCREQSYGSITEDDAIVDSKALALDPAYEAKARILNRAIREIGMGFYQWQLFVVVGFGWASD
NLWPIVTSLIFTPITNEFGPHRPPLFTLAQNIGLLAGAIFWGFGCDVFGRKWGFNLTLGMTAFWGLVAACAPNFA
AIGVFAALWSFGVGGNLPVDSAVFLEFLPQSHQYLLTILSIDWALAQVIANLIAWPLLGYMTCPEDETPCRRRDN
MGWRYFVITIGGITLLMFFARFFFFTIYESPKFLIGKGRDHEAVRVVHEVARRNGKTSDLTVEELKACEPDGYVA
QTSTSTALKRHLEKLEPKRVKVLFSTKRMALSTGLIMSIWALIGLGYPLYNAFLPYIQATRGAQFQDGSTYITYR
NSLIISVLGIPGALLGGFLVEMPGIGRKGTLSIFTMLTGVFLYCSTTATNSTALLGWNCAFNFCSNVMYAVLYGY
TPEIFPTPQRGTGNALAATCNRVFGIMAPIIAMFANLQTSAPVYTSGALFITAGILVLLLPFESRGREAM*
Coding >OphauG2|506
ATGGGTACCGACACGGCGCTCGAAGGGTCTGAGGTGTCGCAGTGCCGTGAGCAAAGCTATGGCAGCATTACTGAA
GATGATGCCATTGTCGATTCCAAAGCATTGGCCCTTGATCCCGCCTACGAAGCCAAGGCTCGAATTCTCAACCGC
GCTATCCGGGAGATTGGCATGGGCTTCTACCAGTGGCAGCTGTTTGTTGTCGTCGGCTTCGGCTGGGCCAGCGAC
AATTTGTGGCCCATAGTCACATCCCTCATCTTTACCCCCATCACAAATGAGTTTGGCCCTCACCGGCCGCCGCTC
TTTACCCTTGCCCAAAACATTGGTCTCCTTGCCGGCGCCATCTTCTGGGGCTTTGGCTGCGATGTCTTTGGCCGC
AAATGGGGCTTCAACCTGACCCTCGGCATGACGGCCTTTTGGGGACTGGTGGCTGCCTGCGCTCCCAATTTTGCC
GCCATTGGTGTCTTTGCCGCCCTTTGGTCCTTTGGTGTCGGCGGGAACCTGCCCGTTGACTCGGCCGTCTTTCTC
GAGTTTCTGCCCCAGTCTCACCAGTATCTGCTCACTATTCTCTCCATAGACTGGGCCCTTGCCCAGGTCATTGCC
AATCTTATTGCCTGGCCACTGCTAGGCTACATGACATGTCCCGAAGATGAGACGCCGTGCAGGCGCAGAGACAAC
ATGGGCTGGCGCTATTTTGTCATCACTATAGGTGGCATAACGCTCCTCATGTTTTTTGCTCGCTTCTTCTTCTTC
ACTATTTACGAGTCGCCCAAATTTCTCATTGGCAAGGGCCGCGACCACGAGGCCGTTCGCGTCGTGCACGAGGTT
GCCCGACGCAATGGCAAGACGTCGGACCTGACGGTGGAAGAGCTCAAGGCTTGCGAGCCTGACGGCTATGTTGCC
CAAACTAGTACGTCAACTGCACTCAAGAGACATCTTGAAAAGCTTGAGCCCAAACGTGTCAAGGTGCTATTCTCG
ACGAAGCGCATGGCTCTGAGCACAGGGCTCATCATGTCCATCTGGGCTCTTATTGGCCTCGGCTATCCTCTTTAC
AACGCCTTTTTGCCTTATATCCAAGCCACAAGGGGGGCCCAGTTCCAGGACGGGAGTACCTACATCACCTACCGC
AATAGCCTTATTATTTCGGTTCTTGGCATTCCTGGCGCCCTTCTTGGCGGATTTCTGGTTGAAATGCCTGGAATA
GGCCGCAAGGGGACGCTTTCCATCTTCACCATGCTTACTGGTGTCTTTCTCTACTGCTCAACAACAGCAACAAAT
AGCACGGCGTTGCTGGGATGGAACTGTGCCTTTAACTTTTGCAGCAACGTCATGTATGCCGTCTTGTACGGCTAC
ACCCCTGAGATTTTTCCCACTCCTCAACGAGGGACGGGCAACGCGCTTGCAGCAACATGCAATCGCGTATTCGGC
ATCATGGCTCCCATCATTGCCATGTTTGCCAACTTGCAGACGTCAGCGCCCGTCTACACTAGCGGCGCGCTCTTC
ATCACGGCGGGCATTCTCGTGCTCCTGCTACCTTTTGAGTCGAGGGGGCGAGAAGCTATGTGA
Transcript >OphauG2|506
ATGGGTACCGACACGGCGCTCGAAGGGTCTGAGGTGTCGCAGTGCCGTGAGCAAAGCTATGGCAGCATTACTGAA
GATGATGCCATTGTCGATTCCAAAGCATTGGCCCTTGATCCCGCCTACGAAGCCAAGGCTCGAATTCTCAACCGC
GCTATCCGGGAGATTGGCATGGGCTTCTACCAGTGGCAGCTGTTTGTTGTCGTCGGCTTCGGCTGGGCCAGCGAC
AATTTGTGGCCCATAGTCACATCCCTCATCTTTACCCCCATCACAAATGAGTTTGGCCCTCACCGGCCGCCGCTC
TTTACCCTTGCCCAAAACATTGGTCTCCTTGCCGGCGCCATCTTCTGGGGCTTTGGCTGCGATGTCTTTGGCCGC
AAATGGGGCTTCAACCTGACCCTCGGCATGACGGCCTTTTGGGGACTGGTGGCTGCCTGCGCTCCCAATTTTGCC
GCCATTGGTGTCTTTGCCGCCCTTTGGTCCTTTGGTGTCGGCGGGAACCTGCCCGTTGACTCGGCCGTCTTTCTC
GAGTTTCTGCCCCAGTCTCACCAGTATCTGCTCACTATTCTCTCCATAGACTGGGCCCTTGCCCAGGTCATTGCC
AATCTTATTGCCTGGCCACTGCTAGGCTACATGACATGTCCCGAAGATGAGACGCCGTGCAGGCGCAGAGACAAC
ATGGGCTGGCGCTATTTTGTCATCACTATAGGTGGCATAACGCTCCTCATGTTTTTTGCTCGCTTCTTCTTCTTC
ACTATTTACGAGTCGCCCAAATTTCTCATTGGCAAGGGCCGCGACCACGAGGCCGTTCGCGTCGTGCACGAGGTT
GCCCGACGCAATGGCAAGACGTCGGACCTGACGGTGGAAGAGCTCAAGGCTTGCGAGCCTGACGGCTATGTTGCC
CAAACTAGTACGTCAACTGCACTCAAGAGACATCTTGAAAAGCTTGAGCCCAAACGTGTCAAGGTGCTATTCTCG
ACGAAGCGCATGGCTCTGAGCACAGGGCTCATCATGTCCATCTGGGCTCTTATTGGCCTCGGCTATCCTCTTTAC
AACGCCTTTTTGCCTTATATCCAAGCCACAAGGGGGGCCCAGTTCCAGGACGGGAGTACCTACATCACCTACCGC
AATAGCCTTATTATTTCGGTTCTTGGCATTCCTGGCGCCCTTCTTGGCGGATTTCTGGTTGAAATGCCTGGAATA
GGCCGCAAGGGGACGCTTTCCATCTTCACCATGCTTACTGGTGTCTTTCTCTACTGCTCAACAACAGCAACAAAT
AGCACGGCGTTGCTGGGATGGAACTGTGCCTTTAACTTTTGCAGCAACGTCATGTATGCCGTCTTGTACGGCTAC
ACCCCTGAGATTTTTCCCACTCCTCAACGAGGGACGGGCAACGCGCTTGCAGCAACATGCAATCGCGTATTCGGC
ATCATGGCTCCCATCATTGCCATGTTTGCCAACTTGCAGACGTCAGCGCCCGTCTACACTAGCGGCGCGCTCTTC
ATCACGGCGGGCATTCTCGTGCTCCTGCTACCTTTTGAGTCGAGGGGGCGAGAAGCTATGTGA
Gene >OphauG2|506
ATGGGTACCGACACGGCGCTCGAAGGGTCTGAGGTGTCGCAGTGCCGTGAGCAAAGCTATGGCAGCATTACTGAA
GATGATGCCATTGTCGATTCCAAAGCATTGGCCCTTGATCCCGCCTACGAAGCCAAGGCTCGAATTCTCAACCGC
GCTGTAAGTCGCGCCTTTGGCTCGTCGGCCACAAACAGCCTCGGGCTCATGACCATGTCCAGATCCGGGAGATTG
GCATGGGCTTCTACCAGTGGCAGCTGTTTGTTGTCGTCGGCTTCGGCTGGGCCAGCGACAATTTGTGGCCCATAG
TCACATCCCTCATCTTTACCCCCATCACAAATGAGTTTGGCCCTCACCGGCCGCCGCTCTTTACCCTTGCCCAAA
ACATTGGTCTCCTTGCCGGCGCCATCTTCTGGGGCTTTGGCTGCGATGTCTTTGGCCGCAAATGGGGCTTCAACC
TGACCCTCGGCATGACGGCCTTTTGGGGACTGGTGGCTGCCTGCGCTCCCAATTTTGCCGCCATTGGTGTCTTTG
CCGCCCTTTGGTCCTTTGGTGTCGGCGGGAACCTGCCCGTTGACTCGGCCGTCTTTCTCGAGTTTCTGCCCCAGT
CTCACCAGTATCTGCTCACTATTCTCTCCATAGACTGGGCCCTTGCCCAGGTCATTGCCAATCTTATTGCCTGGC
CACTGCTAGGCTACATGACATGTCCCGAAGATGAGACGCCGTGCAGGCGCAGAGACAACATGGGCTGGCGCTATT
TTGTCATCACTATAGGTGGCATAACGCTCCTCATGTTTTTTGCTCGCTTCTTCTTCTTCACTATTTACGAGTCGC
CCAAATTTCTCATTGGCAAGGGCCGCGACCACGAGGCCGTTCGCGTCGTGCACGAGGTTGCCCGACGCAATGGCA
AGACGTCGGACCTGACGGTGGAAGAGCTCAAGGCTTGCGAGCCTGACGGCTATGTTGCCCAAACTAGTACGTCAA
CTGCACTCAAGAGACATCTTGAAAAGCTTGAGCCCAAACGTGTCAAGGTGCTATTCTCGACGAAGCGCATGGCTC
TGAGCACAGGGCTCATCATGTCCATCTGGGCTCTTATTGGCCTCGGCTATCCTCTTTACAACGCCTTTTTGCCTT
ATATCCAAGCCACAAGGGGGGCCCAGTTCCAGGACGGGAGTACCTACATCACCTACCGCAATAGCCTTATTATTT
CGGTTCTTGGCATTCCTGGCGCCCTTCTTGGCGGATTTCTGGTTGAAATGCCTGGAATAGGCCGCAAGGGGACGC
TTTCCATCTTCACCATGCTTACTGGTGTCTTTCTCTACTGCTCAACAACAGCAACAAATAGCACGGCGTTGCTGG
GATGGAACTGTGCCTTTAACTTTTGCAGCAACGTCATGTATGCCGTCTTGTACGGCTACACCCCTGAGATTTTTC
CCACTCCTCAACGAGGGACGGGCAACGCGCTTGCAGCAACATGCAATCGCGTATTCGGCATCATGGCTGTAAGTT
GGCCTCTTGTATTTATGGGGGCAGTTCTAACATTTTACAAAAGCCCATCATTGCCATGTTTGCCAACTTGCAGAC
GTCAGCGCCCGTCTACACTAGCGGCGCGCTCTTCATCACGGCGGGCATTCTCGTGCTCCTGCTACCTTTTGAGTC
GAGGGGGCGAGAAGCTATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail