Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5053
Gene name
LocationContig_448:2003..4297
Strand+
Gene length (bp)2294
Transcript length (bp)2163
Coding sequence length (bp)2163
Protein length (aa) 721

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 1.0E-17 177 339
PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2 9.9E-10 69 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 126 388 8.0E-12
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 125 369 1.0E-11
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 59 337 3.0E-11
sp|Q04786|HEX_VIBVL Beta-hexosaminidase OS=Vibrio vulnificus GN=hex PE=3 SV=1 66 290 9.0E-10
sp|Q8L7S6|HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana GN=HEXO3 PE=1 SV=1 170 339 9.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 126 388 8.0E-12
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 125 369 1.0E-11
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 59 337 3.0E-11
sp|Q04786|HEX_VIBVL Beta-hexosaminidase OS=Vibrio vulnificus GN=hex PE=3 SV=1 66 290 9.0E-10
sp|Q8L7S6|HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana GN=HEXO3 PE=1 SV=1 170 339 9.0E-08
sp|P13723|HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum GN=hexa1 PE=1 SV=1 125 337 1.0E-07
sp|E9DFH0|HEX1_COCPS Beta-hexosaminidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=HEX1 PE=1 SV=1 125 413 2.0E-07
sp|D4AYT4|HEX2_ARTBC Probable beta-hexosaminidase ARB_01353 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01353 PE=1 SV=1 125 416 4.0E-07
sp|P49010|HEXC_BOMMO Chitooligosaccharidolytic beta-N-acetylglucosaminidase OS=Bombyx mori PE=1 SV=1 88 431 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5053
MWQARLFTVVGVVAHSFIFGAAEARLGTIPSTPFTARDGTYSLDQLKSIIYDKRYAQAVDDKGQTLIPETLEQFA
HTFQQDVAASLGIAVPVVAGEGDEAVAHSIFMTLDAEADFLDAAGRPTAEGYRLVVNELGITIAGASPLGVWWGT
RTLLQAAVLGNNSMAHGQGVDAPGWAIRGLMIDGGRKFYPAGFVAEMCAYLSFFKQNTLQLHLSDNLNNYPDRYS
EERTLSLYSAFRLWSQDAAVAGLAQLRNESYSRTEFDWMQSQCAKRGVTLVPEIEAPGHALAIVKWRRRIALETD
LSMLNISHPDTLPTLESIWSVFLPWFQCKTVHIGADEYDGRLVAQYSRLVNSMAAFIKQQSGKATRIWGTFTPNQ
GANVSRDVVMQHWSRRMDDALHDYIDNGYQVVNADNAFYVVGKWSPAYPPRLKKTLVFSGNPATSGSFSPNILDT
SDASRNAPRDSPSIQGHLAALWNDWGPNGTTVLEAYHSVRDALPALGDKQWGGDLTEHEYDSVIDVLRDAAPGQN
LDRRIKSLTNVLVEYRFANITEDGLIVDTSGNGYHGRLQGKGCTLTTSASLYLSGMCQMATPLSSKGRDYILSFS
IKPFQPRRISTLFMGPDSALVANQDGSLAMLSDGHYYQLDPSYTLPINRWTTVSLIARDDQTVVKVSIDGHAPRY
MKFSTQLGIWGLKLRGAPMAFEAPLATIGLGFVGLIKDISLRVHA*
Coding >OphauG2|5053
ATGTGGCAAGCAAGGCTGTTTACGGTGGTTGGAGTGGTGGCTCACTCGTTCATCTTTGGCGCTGCAGAGGCTCGT
CTGGGGACGATACCAAGCACTCCCTTTACCGCCAGAGATGGAACCTACTCATTAGACCAGCTCAAGAGCATCATA
TACGACAAGCGCTACGCGCAAGCTGTGGACGACAAGGGACAGACATTGATTCCAGAGACGCTGGAGCAGTTTGCC
CATACCTTTCAACAAGATGTGGCGGCAAGCCTTGGCATCGCTGTGCCTGTTGTCGCGGGCGAGGGCGACGAGGCT
GTGGCGCATTCCATCTTTATGACGCTCGATGCCGAGGCGGACTTCTTGGATGCAGCGGGCCGGCCAACAGCAGAG
GGCTACCGGCTCGTCGTCAACGAGCTGGGCATCACAATAGCGGGCGCGAGTCCGCTGGGCGTGTGGTGGGGGACG
CGGACGCTTCTCCAGGCCGCCGTCCTGGGCAACAACAGCATGGCGCATGGCCAAGGCGTGGATGCGCCGGGATGG
GCCATTCGCGGACTCATGATTGACGGCGGGCGCAAGTTCTACCCCGCGGGGTTTGTAGCCGAAATGTGTGCCTAT
CTGTCCTTTTTCAAACAAAACACGCTGCAGCTGCACCTGAGTGACAACCTCAACAACTATCCAGACCGCTACTCG
GAGGAGCGCACCTTGAGTCTCTACTCGGCCTTCCGGCTGTGGTCTCAAGACGCAGCCGTGGCAGGCTTGGCCCAG
CTGCGCAACGAGTCGTACTCACGCACAGAGTTTGACTGGATGCAGAGCCAGTGCGCCAAGAGAGGCGTGACGCTG
GTGCCCGAGATTGAGGCGCCGGGACACGCCCTGGCCATTGTCAAGTGGCGCCGCCGCATTGCCCTCGAGACGGAC
CTCAGCATGCTCAATATTTCGCACCCAGACACGCTGCCGACCCTCGAGTCCATCTGGAGCGTCTTTCTGCCCTGG
TTCCAGTGCAAGACGGTGCACATTGGGGCCGATGAGTACGACGGCAGGCTCGTGGCCCAATACTCGCGCCTTGTC
AATAGCATGGCAGCCTTTATCAAGCAACAGTCGGGCAAGGCCACGCGCATTTGGGGCACCTTTACACCCAACCAG
GGCGCCAACGTGTCGAGAGACGTCGTGATGCAGCACTGGTCACGGCGCATGGACGACGCGTTGCACGACTACATC
GACAATGGATACCAAGTCGTCAATGCCGACAACGCCTTTTATGTCGTGGGCAAATGGTCGCCGGCATATCCACCG
CGGCTGAAGAAGACTCTCGTCTTTTCCGGTAATCCCGCTACCAGCGGATCCTTCTCGCCAAACATCTTGGACACG
TCTGACGCGTCACGAAATGCCCCTCGCGACTCTCCAAGCATCCAGGGCCACCTGGCCGCTCTTTGGAACGACTGG
GGGCCCAACGGCACCACTGTGCTCGAGGCATACCACTCTGTGCGCGACGCCCTGCCGGCGCTCGGCGACAAGCAA
TGGGGTGGCGATCTGACCGAGCACGAGTACGACAGCGTCATTGACGTGTTGCGCGACGCTGCGCCCGGCCAAAAT
CTCGACCGACGAATCAAATCACTGACCAACGTCCTCGTCGAGTATCGTTTTGCCAACATAACCGAAGACGGGCTC
ATCGTCGACACCTCGGGAAACGGCTACCACGGCCGTCTGCAGGGCAAAGGCTGCACCCTGACGACCAGCGCTTCT
CTCTATCTGTCCGGCATGTGCCAAATGGCGACGCCTCTGAGTAGCAAAGGACGCGACTACATTCTGTCATTTTCG
ATAAAACCTTTCCAGCCTCGTCGCATCAGCACTCTATTCATGGGCCCTGACTCGGCTCTTGTCGCGAATCAAGAC
GGCAGCTTGGCCATGTTGAGTGACGGGCACTATTACCAGCTTGATCCGTCCTATACTCTCCCCATTAACCGTTGG
ACCACGGTCAGCCTTATCGCACGCGACGACCAAACAGTTGTAAAGGTGTCGATAGATGGCCATGCACCGCGCTAC
ATGAAGTTTTCAACCCAGCTTGGCATTTGGGGGCTGAAATTACGTGGTGCTCCAATGGCCTTTGAAGCTCCTCTG
GCAACCATTGGTCTTGGCTTTGTCGGCCTGATCAAGGACATTTCGCTGCGAGTCCACGCATGA
Transcript >OphauG2|5053
ATGTGGCAAGCAAGGCTGTTTACGGTGGTTGGAGTGGTGGCTCACTCGTTCATCTTTGGCGCTGCAGAGGCTCGT
CTGGGGACGATACCAAGCACTCCCTTTACCGCCAGAGATGGAACCTACTCATTAGACCAGCTCAAGAGCATCATA
TACGACAAGCGCTACGCGCAAGCTGTGGACGACAAGGGACAGACATTGATTCCAGAGACGCTGGAGCAGTTTGCC
CATACCTTTCAACAAGATGTGGCGGCAAGCCTTGGCATCGCTGTGCCTGTTGTCGCGGGCGAGGGCGACGAGGCT
GTGGCGCATTCCATCTTTATGACGCTCGATGCCGAGGCGGACTTCTTGGATGCAGCGGGCCGGCCAACAGCAGAG
GGCTACCGGCTCGTCGTCAACGAGCTGGGCATCACAATAGCGGGCGCGAGTCCGCTGGGCGTGTGGTGGGGGACG
CGGACGCTTCTCCAGGCCGCCGTCCTGGGCAACAACAGCATGGCGCATGGCCAAGGCGTGGATGCGCCGGGATGG
GCCATTCGCGGACTCATGATTGACGGCGGGCGCAAGTTCTACCCCGCGGGGTTTGTAGCCGAAATGTGTGCCTAT
CTGTCCTTTTTCAAACAAAACACGCTGCAGCTGCACCTGAGTGACAACCTCAACAACTATCCAGACCGCTACTCG
GAGGAGCGCACCTTGAGTCTCTACTCGGCCTTCCGGCTGTGGTCTCAAGACGCAGCCGTGGCAGGCTTGGCCCAG
CTGCGCAACGAGTCGTACTCACGCACAGAGTTTGACTGGATGCAGAGCCAGTGCGCCAAGAGAGGCGTGACGCTG
GTGCCCGAGATTGAGGCGCCGGGACACGCCCTGGCCATTGTCAAGTGGCGCCGCCGCATTGCCCTCGAGACGGAC
CTCAGCATGCTCAATATTTCGCACCCAGACACGCTGCCGACCCTCGAGTCCATCTGGAGCGTCTTTCTGCCCTGG
TTCCAGTGCAAGACGGTGCACATTGGGGCCGATGAGTACGACGGCAGGCTCGTGGCCCAATACTCGCGCCTTGTC
AATAGCATGGCAGCCTTTATCAAGCAACAGTCGGGCAAGGCCACGCGCATTTGGGGCACCTTTACACCCAACCAG
GGCGCCAACGTGTCGAGAGACGTCGTGATGCAGCACTGGTCACGGCGCATGGACGACGCGTTGCACGACTACATC
GACAATGGATACCAAGTCGTCAATGCCGACAACGCCTTTTATGTCGTGGGCAAATGGTCGCCGGCATATCCACCG
CGGCTGAAGAAGACTCTCGTCTTTTCCGGTAATCCCGCTACCAGCGGATCCTTCTCGCCAAACATCTTGGACACG
TCTGACGCGTCACGAAATGCCCCTCGCGACTCTCCAAGCATCCAGGGCCACCTGGCCGCTCTTTGGAACGACTGG
GGGCCCAACGGCACCACTGTGCTCGAGGCATACCACTCTGTGCGCGACGCCCTGCCGGCGCTCGGCGACAAGCAA
TGGGGTGGCGATCTGACCGAGCACGAGTACGACAGCGTCATTGACGTGTTGCGCGACGCTGCGCCCGGCCAAAAT
CTCGACCGACGAATCAAATCACTGACCAACGTCCTCGTCGAGTATCGTTTTGCCAACATAACCGAAGACGGGCTC
ATCGTCGACACCTCGGGAAACGGCTACCACGGCCGTCTGCAGGGCAAAGGCTGCACCCTGACGACCAGCGCTTCT
CTCTATCTGTCCGGCATGTGCCAAATGGCGACGCCTCTGAGTAGCAAAGGACGCGACTACATTCTGTCATTTTCG
ATAAAACCTTTCCAGCCTCGTCGCATCAGCACTCTATTCATGGGCCCTGACTCGGCTCTTGTCGCGAATCAAGAC
GGCAGCTTGGCCATGTTGAGTGACGGGCACTATTACCAGCTTGATCCGTCCTATACTCTCCCCATTAACCGTTGG
ACCACGGTCAGCCTTATCGCACGCGACGACCAAACAGTTGTAAAGGTGTCGATAGATGGCCATGCACCGCGCTAC
ATGAAGTTTTCAACCCAGCTTGGCATTTGGGGGCTGAAATTACGTGGTGCTCCAATGGCCTTTGAAGCTCCTCTG
GCAACCATTGGTCTTGGCTTTGTCGGCCTGATCAAGGACATTTCGCTGCGAGTCCACGCATGA
Gene >OphauG2|5053
ATGTGGCAAGCAAGGCTGTTTACGGTGGTTGGAGTGGTGGCTCACTCGTTCATCTTTGGTATCTTGATCTGCAGA
ATCTTTTTTCAAAAGACGTAATTTGGCAGGATTGCGGCTGACCAAATGAGGTGTAAAAGGCGCTGCAGAGGCTCG
TCTGGGGACGATACCAAGCACTCCCTTTACCGCCAGAGATGGAACCTACTCATTAGACCAGCTCAAGAGCATCAT
ATACGACAAGCGCTACGCGCAAGCTGTGGACGACAAGGGACAGACATTGATTCCAGAGACGCTGGAGCAGTTTGC
CCATACCTTTCAACAAGATGTGGCGGCAAGCCTTGGCATCGCTGTGCCTGTTGTCGCGGGCGAGGGCGACGAGGC
TGTGGCGCATTCCATCTTTATGACGCTCGATGCCGAGGCGGACTTCTTGGATGCAGCGGGCCGGCCAACAGCAGA
GGGCTACCGGCTCGTCGTCAACGAGCTGGGCATCACAATAGCGGGCGCGAGTCCGCTGGGCGTGTGGTGGGGGAC
GCGGACGCTTCTCCAGGCCGCCGTCCTGGGCAACAACAGCATGGCGCATGGCCAAGGCGTGGATGCGCCGGGATG
GGCCATTCGCGGACTCATGGTAGCAAGCGCGTGGCGCCCCTGACAAGCGGCCGCCAAGACTGACTGGGCCACAGA
TTGACGGCGGGCGCAAGTTCTACCCCGCGGGGTTTGTAGCCGAAATGTGTGCCTATCTGTCCTTTTTCAAACAAA
ACACGCTGCAGCTGCACCTGAGTGACAACCTCAACAACTATCCAGACCGCTACTCGGAGGAGCGCACCTTGAGTC
TCTACTCGGCCTTCCGGCTGTGGTCTCAAGACGCAGCCGTGGCAGGCTTGGCCCAGCTGCGCAACGAGTCGTACT
CACGCACAGAGTTTGACTGGATGCAGAGCCAGTGCGCCAAGAGAGGCGTGACGCTGGTGCCCGAGATTGAGGCGC
CGGGACACGCCCTGGCCATTGTCAAGTGGCGCCGCCGCATTGCCCTCGAGACGGACCTCAGCATGCTCAATATTT
CGCACCCAGACACGCTGCCGACCCTCGAGTCCATCTGGAGCGTCTTTCTGCCCTGGTTCCAGTGCAAGACGGTGC
ACATTGGGGCCGATGAGTACGACGGCAGGCTCGTGGCCCAATACTCGCGCCTTGTCAATAGCATGGCAGCCTTTA
TCAAGCAACAGTCGGGCAAGGCCACGCGCATTTGGGGCACCTTTACACCCAACCAGGGCGCCAACGTGTCGAGAG
ACGTCGTGATGCAGCACTGGTCACGGCGCATGGACGACGCGTTGCACGACTACATCGACAATGGATACCAAGTCG
TCAATGCCGACAACGCCTTTTATGTCGTGGGCAAATGGTCGCCGGCATATCCACCGCGGCTGAAGAAGACTCTCG
TCTTTTCCGGTAATCCCGCTACCAGCGGATCCTTCTCGCCAAACATCTTGGACACGTCTGACGCGTCACGAAATG
CCCCTCGCGACTCTCCAAGCATCCAGGGCCACCTGGCCGCTCTTTGGAACGACTGGGGGCCCAACGGCACCACTG
TGCTCGAGGCATACCACTCTGTGCGCGACGCCCTGCCGGCGCTCGGCGACAAGCAATGGGGTGGCGATCTGACCG
AGCACGAGTACGACAGCGTCATTGACGTGTTGCGCGACGCTGCGCCCGGCCAAAATCTCGACCGACGAATCAAAT
CACTGACCAACGTCCTCGTCGAGTATCGTTTTGCCAACATAACCGAAGACGGGCTCATCGTCGACACCTCGGGAA
ACGGCTACCACGGCCGTCTGCAGGGCAAAGGCTGCACCCTGACGACCAGCGCTTCTCTCTATCTGTCCGGCATGT
GCCAAATGGCGACGCCTCTGAGTAGCAAAGGACGCGACTACATTCTGTCATTTTCGATAAAACCTTTCCAGCCTC
GTCGCATCAGCACTCTATTCATGGGCCCTGACTCGGCTCTTGTCGCGAATCAAGACGGCAGCTTGGCCATGTTGA
GTGACGGGCACTATTACCAGCTTGATCCGTCCTATACTCTCCCCATTAACCGTTGGACCACGGTCAGCCTTATCG
CACGCGACGACCAAACAGTTGTAAAGGTGTCGATAGATGGCCATGCACCGCGCTACATGAAGTTTTCAACCCAGC
TTGGCATTTGGGGGCTGAAATTACGTGGTGCTCCAATGGCCTTTGAAGCTCCTCTGGCAACCATTGGTCTTGGCT
TTGTCGGCCTGATCAAGGACATTTCGCTGCGAGTCCACGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail