Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5044
Gene name
LocationContig_445:10704..14738
Strand+
Gene length (bp)4034
Transcript length (bp)3855
Coding sequence length (bp)3855
Protein length (aa) 1285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02383 Syja_N SacI homology domain 1.9E-72 102 450
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 3.3E-09 664 947

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 23 1173 0.0E+00
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 23 1086 0.0E+00
sp|Q12271|INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP53 PE=1 SV=1 24 980 0.0E+00
sp|P40559|INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP51 PE=1 SV=1 103 1062 3.0E-156
sp|Q9USQ6|SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj2 PE=2 SV=1 76 958 2.0E-123
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 23 1173 0.0E+00
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 23 1086 0.0E+00
sp|Q12271|INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP53 PE=1 SV=1 24 980 0.0E+00
sp|P40559|INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP51 PE=1 SV=1 103 1062 3.0E-156
sp|Q9USQ6|SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj2 PE=2 SV=1 76 958 2.0E-123
sp|O15056|SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens GN=SYNJ2 PE=1 SV=3 195 972 2.0E-113
sp|Q9D2G5|SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus GN=Synj2 PE=1 SV=2 195 972 5.0E-112
sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 183 972 7.0E-112
sp|Q62910|SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 SV=3 183 972 9.0E-112
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE=1 SV=3 183 972 1.0E-111
sp|O18964|SYNJ1_BOVIN Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 PE=1 SV=2 183 972 2.0E-110
sp|O55207|SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus GN=Synj2 PE=1 SV=2 195 972 2.0E-109
sp|Q8K337|I5P2_MOUSE Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Mus musculus GN=Inpp5b PE=1 SV=1 642 972 1.0E-61
sp|P32019|I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens GN=INPP5B PE=1 SV=4 642 972 2.0E-61
sp|Q01968|OCRL_HUMAN Inositol polyphosphate 5-phosphatase OCRL-1 OS=Homo sapiens GN=OCRL PE=1 SV=3 646 973 4.0E-58
sp|Q6NVF0|OCRL_MOUSE Inositol polyphosphate 5-phosphatase OCRL-1 OS=Mus musculus GN=Ocrl PE=1 SV=1 646 972 2.0E-56
sp|D3ZGS3|OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL-1 OS=Rattus norvegicus GN=Ocrl PE=1 SV=1 646 972 2.0E-56
sp|A1L244|SAC1A_DANRE Phosphatidylinositide phosphatase SAC1-A OS=Danio rerio GN=sacm1la PE=2 SV=1 195 624 2.0E-49
sp|Q9ES21|SAC1_RAT Phosphatidylinositide phosphatase SAC1 OS=Rattus norvegicus GN=Sacm1l PE=1 SV=1 97 624 3.0E-49
sp|Q9EP69|SAC1_MOUSE Phosphatidylinositide phosphatase SAC1 OS=Mus musculus GN=Sacm1l PE=1 SV=1 97 624 2.0E-48
sp|Q9NTJ5|SAC1_HUMAN Phosphatidylinositide phosphatase SAC1 OS=Homo sapiens GN=SACM1L PE=1 SV=2 97 624 3.0E-48
sp|Q5R921|SAC1_PONAB Phosphatidylinositide phosphatase SAC1 OS=Pongo abelii GN=SACM1L PE=2 SV=1 97 624 4.0E-48
sp|Q6GM29|SAC1_XENLA Phosphatidylinositide phosphatase SAC1 OS=Xenopus laevis GN=sacm1l PE=2 SV=1 99 624 4.0E-47
sp|P32368|SAC1_YEAST Phosphoinositide phosphatase SAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC1 PE=1 SV=1 199 624 1.0E-46
sp|Q0WT19|IP5P8_ARATH Type I inositol polyphosphate 5-phosphatase 8 OS=Arabidopsis thaliana GN=IP5P8 PE=2 SV=1 659 967 2.0E-46
sp|A6QL88|SAC1_BOVIN Phosphatidylinositide phosphatase SAC1 OS=Bos taurus GN=SACM1L PE=2 SV=1 97 624 2.0E-46
sp|Q55AW9|SAC1_DICDI Phosphatidylinositide phosphatase SAC1 OS=Dictyostelium discoideum GN=sac1 PE=3 SV=1 195 616 6.0E-46
sp|A4VCH0|SAC1B_DANRE Phosphatidylinositide phosphatase SAC1-B OS=Danio rerio GN=sacm1lb PE=2 SV=2 99 624 2.0E-45
sp|O14306|YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.10c PE=1 SV=2 638 1001 2.0E-44
sp|Q9SIS4|IP5P9_ARATH Type IV inositol polyphosphate 5-phosphatase 9 OS=Arabidopsis thaliana GN=IP5P9 PE=1 SV=1 693 960 3.0E-44
sp|Q9LR47|IP5P6_ARATH Type IV inositol polyphosphate 5-phosphatase 6 OS=Arabidopsis thaliana GN=IP5P6 PE=1 SV=2 741 981 2.0E-43
sp|Q66GQ6|IP5P5_ARATH Type I inositol polyphosphate 5-phosphatase 5 OS=Arabidopsis thaliana GN=IP5P5 PE=2 SV=1 738 960 3.0E-43
sp|Q0WQ41|IP5P7_ARATH Type IV inositol polyphosphate 5-phosphatase 7 OS=Arabidopsis thaliana GN=IP5P7 PE=1 SV=1 741 1002 4.0E-43
sp|A8E7C5|SAC2_DANRE Phosphatidylinositide phosphatase SAC2 OS=Danio rerio GN=inpp5f PE=3 SV=1 196 624 2.0E-42
sp|Q9W0I6|SAC1_DROME Phosphatidylinositide phosphatase SAC1 OS=Drosophila melanogaster GN=Sac1 PE=2 SV=1 84 627 7.0E-42
sp|Q8GTS0|IP5P4_ARATH Type I inositol polyphosphate 5-phosphatase 4 OS=Arabidopsis thaliana GN=IP5P4 PE=2 SV=1 733 973 2.0E-41
sp|Q9Y2H2|SAC2_HUMAN Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens GN=INPP5F PE=1 SV=3 198 624 6.0E-41
sp|Q84MA2|IP5P1_ARATH Type I inositol polyphosphate 5-phosphatase 1 OS=Arabidopsis thaliana GN=IP5P1 PE=1 SV=2 708 961 8.0E-41
sp|A8MR21|IP5PA_ARATH Type I inositol polyphosphate 5-phosphatase 10 OS=Arabidopsis thaliana GN=IP5P10 PE=2 SV=1 740 962 3.0E-40
sp|Q8H0Z6|IP5P3_ARATH Type IV inositol polyphosphate 5-phosphatase 3 OS=Arabidopsis thaliana GN=IP5P3 PE=1 SV=1 742 1000 5.0E-40
sp|Q8CDA1|SAC2_MOUSE Phosphatidylinositide phosphatase SAC2 OS=Mus musculus GN=Inpp5f PE=1 SV=1 198 624 9.0E-40
sp|Q96328|SAC8_ARATH Phosphoinositide phosphatase SAC8 OS=Arabidopsis thaliana GN=SAC8 PE=2 SV=1 195 625 5.0E-39
sp|Q9JII1|INP5E_MOUSE 72 kDa inositol polyphosphate 5-phosphatase OS=Mus musculus GN=Inpp5e PE=1 SV=1 645 958 1.0E-38
sp|Q9C5G5|SAC7_ARATH Phosphoinositide phosphatase SAC7 OS=Arabidopsis thaliana GN=SAC7 PE=2 SV=1 298 627 2.0E-38
sp|A0FI79|INP5E_PANTR 72 kDa inositol polyphosphate 5-phosphatase OS=Pan troglodytes GN=INPP5E PE=2 SV=1 622 958 3.0E-38
sp|Q9WVR1|INP5E_RAT 72 kDa inositol polyphosphate 5-phosphatase OS=Rattus norvegicus GN=Inpp5e PE=1 SV=2 622 958 3.0E-38
sp|Q9NRR6|INP5E_HUMAN 72 kDa inositol polyphosphate 5-phosphatase OS=Homo sapiens GN=INPP5E PE=1 SV=2 622 958 3.0E-38
sp|O60162|YG23_SCHPO Uncharacterized protein C19F5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F5.03 PE=1 SV=1 194 626 7.0E-38
sp|Q7X911|SAC6_ARATH Phosphoinositide phosphatase SAC6 OS=Arabidopsis thaliana GN=SAC6 PE=2 SV=1 250 627 1.0E-37
sp|Q9JMC1|PI5PA_RAT Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Rattus norvegicus GN=Inpp5j PE=1 SV=1 689 972 6.0E-36
sp|Q9FUR2|IP5P2_ARATH Type I inositol polyphosphate 5-phosphatase 2 OS=Arabidopsis thaliana GN=IP5P2 PE=1 SV=2 723 962 7.0E-36
sp|P59644|PI5PA_MOUSE Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Mus musculus GN=Inpp5j PE=1 SV=2 689 972 2.0E-35
sp|Q15735|PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens GN=INPP5J PE=1 SV=3 738 972 2.0E-35
sp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 15 OS=Arabidopsis thaliana GN=IP5P15 PE=1 SV=2 637 968 2.0E-34
sp|O14127|YF51_SCHPO Uncharacterized protein C3C7.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.01c PE=3 SV=2 181 624 3.0E-33
sp|Q9BT40|INP5K_HUMAN Inositol polyphosphate 5-phosphatase K OS=Homo sapiens GN=INPP5K PE=1 SV=3 694 958 5.0E-29
sp|O80560|IP5PC_ARATH Type I inositol polyphosphate 5-phosphatase 12 OS=Arabidopsis thaliana GN=IP5P12 PE=1 SV=2 637 968 6.0E-29
sp|Q7XZU3|SAC1_ARATH Phosphoinositide phosphatase SAC1 OS=Arabidopsis thaliana GN=SAC1 PE=1 SV=1 196 713 2.0E-28
sp|Q9SKB7|IP5PE_ARATH Type II inositol polyphosphate 5-phosphatase 14 OS=Arabidopsis thaliana GN=IP5P14 PE=1 SV=1 637 968 1.0E-27
sp|Q9SYK4|IP5PD_ARATH Type I inositol polyphosphate 5-phosphatase 13 OS=Arabidopsis thaliana GN=IP5P13 PE=1 SV=1 637 968 1.0E-27
sp|Q8C5L6|INP5K_MOUSE Inositol polyphosphate 5-phosphatase K OS=Mus musculus GN=Inpp5k PE=1 SV=2 678 959 5.0E-27
sp|P42837|FIG4_YEAST Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FIG4 PE=1 SV=1 203 624 7.0E-27
sp|Q5EAF2|IP5PB_ARATH Type IV inositol polyphosphate 5-phosphatase 11 OS=Arabidopsis thaliana GN=IP5P11 PE=1 SV=1 778 957 8.0E-27
sp|Q2I6J1|SHP2A_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A OS=Danio rerio GN=inppl1a PE=2 SV=2 659 959 9.0E-26
sp|O15357|SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens GN=INPPL1 PE=1 SV=2 659 974 3.0E-25
sp|Q9WVR3|SHIP2_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus GN=Inppl1 PE=1 SV=1 659 959 8.0E-25
sp|Q6P549|SHIP2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus GN=Inppl1 PE=1 SV=1 657 974 8.0E-25
sp|P97573|SHIP1_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Rattus norvegicus GN=Inpp5d PE=1 SV=1 645 959 2.0E-24
sp|Q94A27|SAC2_ARATH Phosphoinositide phosphatase SAC2 OS=Arabidopsis thaliana GN=SAC2 PE=2 SV=1 102 624 3.0E-24
sp|Q9ES52|SHIP1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Mus musculus GN=Inpp5d PE=1 SV=2 645 959 5.0E-24
sp|Q91WF7|FIG4_MOUSE Polyphosphoinositide phosphatase OS=Mus musculus GN=Fig4 PE=1 SV=1 266 624 7.0E-24
sp|Q92835|SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens GN=INPP5D PE=1 SV=2 645 959 2.0E-23
sp|Q8RW97|SAC5_ARATH Phosphoinositide phosphatase SAC5 OS=Arabidopsis thaliana GN=SAC5 PE=2 SV=1 196 626 2.0E-23
sp|Q6P4S2|SHIP1_XENLA Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Xenopus laevis GN=inpp5d PE=2 SV=1 659 959 6.0E-23
sp|Q7XZU2|SAC3_ARATH Phosphoinositide phosphatase SAC3 OS=Arabidopsis thaliana GN=SAC3 PE=2 SV=1 204 624 3.0E-22
sp|Q92562|FIG4_HUMAN Polyphosphoinositide phosphatase OS=Homo sapiens GN=FIG4 PE=1 SV=1 266 624 6.0E-22
sp|P34370|I5P2_CAEEL Inositol polyphosphate 5-phosphatase OS=Caenorhabditis elegans GN=cil-1 PE=1 SV=1 741 954 6.0E-21
sp|Q2I6J0|SHP2B_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2B OS=Danio rerio GN=inppl1b PE=2 SV=1 654 958 3.0E-19
sp|Q08227|INP54_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP54 PE=1 SV=1 691 950 8.0E-15
sp|Q7XZU1|SAC4_ARATH Phosphoinositide phosphatase SAC4 OS=Arabidopsis thaliana GN=SAC4 PE=2 SV=1 204 446 2.0E-11
sp|Q7Z9H9|FIG4_SCHPO Polyphosphoinositide phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.03 PE=3 SV=3 512 635 9.0E-09
sp|Q7Z9H9|FIG4_SCHPO Polyphosphoinositide phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.03 PE=3 SV=3 203 357 3.0E-08
sp|Q7XZU1|SAC4_ARATH Phosphoinositide phosphatase SAC4 OS=Arabidopsis thaliana GN=SAC4 PE=2 SV=1 512 624 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016791 phosphatase activity Yes
GO:0003824 catalytic activity Yes
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5044
MDAQQPPHTSWAAPPPAPEKSSELLIRDYPQRSIAIVSSSHALILRYSSSATETQHNGSHASLASARSRTAESTV
AKCMVEFSPVSQPLLAQYRPLAPRPIYGTLGLMAVDGQVFLSVITRAVRAATVRPGETVERISSVAFYCLSSANY
DDVVPLEPSESDMSEASWAYGNASSFYGQGLGRRDVPPEHPCHDLRKLLSNGSFYYSTDFDVTSRLQARPLNTNS
FEIDNFDDTYLWNSFMISPLVQFRSRLMPPEREALDSSRILTSAIRGFCKTMTIPQSSSPLASGSTSGKPSYLTL
ISRLSCRRAGTRFNSRGIDDDGHVANFVESETTFWSPVGVLFSYAQVRGSVPVFWEQTAELLPGRQKITITRSSE
GTQPVLNKHFEELEHIYGAVHIINLLSETKPAEMELSRLYRQGVRNCPLSRPGVDASPDHALLRETHYDFHAETK
GPAGYEAARDIRHYIERSTDTFAYFLAQEAVDGDGDKEKDRNKSEDEQRRQRGSHLVVVLQQDGVFRTNCLDCLD
RTNLIQTLISQMAIETFLAHRNEYAASDFWMRHASLWADNGDSLSKIYAGTGALKSSFTRHGKMSLAGAVADMRK
SVQRIYHNNFIDPSRQVTIDMLLGRLIGQAAVLLYDPISDYVSVEVARRSDEYTSFEKISIWAGTFNLNGRTQGI
DKDLSPWLLPRSLDADLADVYVVAFQEIVELSPQQIMNSDPSRRHLWESAVKHCLNRRQASRGGVKYVLLRSGQL
VGAALCIFVRASVLCHIKNVEGSVKKTGLSGMAGNKGAVAIRFDFANTHVCFVTAHLAAGFSNYEERNRDYATIH
EGLRFQRNRGIEDHDAIIWLGDFNYRIGLALEATRALMKRGDLGTLYENDQLNLQMVAGLAFHFYSEARISFMPT
YKFDVGTDDYDTSEKARIPAWTDRILKKGAILRQLSYESAPLRFSDHRPVYASFECKVSIVDETLREKISQESYQ
RRKAELGDTTAHVGEDQETEDEDLIGYDAIEPGLPPASSDKHKWWLDHGQPARAHVMAPSGSDGQCMALNPQRPS
NPFGAGDEPDWVSVRRLSVSSLSSSTYEKVPLPPRPGGPATGRPDDVEHGEAAMQPCGTRGQQGRPAPPPPPRMG
ARAGPLDSAIKQQRAAETGSKSPSARLPAPPVAKKPAHLLATKARAKNKTPAATGAATAAVAAAAAAAAGAGAGA
GAGATSDIGANSNGGTRTVAQLAPAWSRASATAARRGGRDGQKTWPRDEEAGNGDESLLDSALDERLGESMRIGG
WEALQPSKS*
Coding >OphauG2|5044
ATGGACGCCCAGCAGCCACCGCATACTTCGTGGGCCGCGCCTCCTCCCGCCCCGGAAAAGTCGAGCGAGCTGCTC
ATCCGCGACTATCCCCAGCGGTCCATTGCCATTGTGTCGTCGTCGCACGCTCTCATCTTGCGCTACAGCTCCTCG
GCGACGGAGACGCAGCACAATGGCTCCCACGCGTCTTTGGCATCGGCCCGATCGCGCACCGCCGAGTCGACTGTT
GCCAAGTGCATGGTGGAGTTTTCCCCCGTTTCGCAGCCGCTCCTTGCCCAGTACCGCCCACTTGCGCCACGGCCG
ATATACGGAACCTTGGGCCTCATGGCCGTTGACGGCCAAGTCTTCCTCTCCGTCATCACACGCGCCGTTAGGGCC
GCCACTGTCCGGCCCGGCGAGACGGTGGAGCGAATATCGAGCGTGGCCTTTTACTGCCTCAGCAGCGCAAATTAC
GACGACGTGGTCCCTCTGGAGCCCAGCGAGTCGGACATGTCCGAGGCCTCTTGGGCATATGGTAACGCTTCCTCG
TTTTACGGTCAGGGTCTCGGTAGGCGCGATGTGCCTCCCGAGCACCCGTGCCACGATTTACGCAAGCTGCTCAGC
AACGGCTCCTTTTATTATAGCACAGACTTCGACGTAACAAGCCGCCTGCAGGCAAGGCCCTTGAATACCAATTCT
TTTGAAATTGACAACTTTGATGACACGTACTTGTGGAACTCGTTCATGATCAGTCCACTTGTTCAGTTCCGCTCG
CGGCTCATGCCCCCCGAGCGCGAGGCCCTGGATTCGTCTCGCATTCTCACGTCGGCCATCCGAGGCTTCTGCAAA
ACCATGACAATACCACAGAGCTCGTCTCCCCTTGCATCAGGCTCTACAAGTGGAAAGCCGTCATATCTGACGCTC
ATATCGCGCCTGTCCTGCAGGCGAGCGGGGACTCGCTTCAACTCTCGAGGCATCGATGACGACGGGCACGTGGCC
AACTTTGTCGAGTCTGAGACGACGTTTTGGAGCCCAGTTGGCGTCTTGTTTTCCTATGCGCAAGTCAGAGGGTCA
GTGCCCGTGTTTTGGGAACAGACTGCCGAGCTGCTGCCAGGGAGGCAGAAAATCACCATCACCAGGTCGTCCGAG
GGCACGCAGCCAGTCCTGAACAAGCACTTTGAGGAACTCGAGCACATTTACGGCGCCGTCCACATCATCAACCTT
CTCAGCGAGACCAAGCCGGCCGAGATGGAGCTGAGCAGGCTGTATCGACAGGGCGTGCGCAACTGTCCATTGAGT
CGGCCTGGCGTCGACGCATCACCAGACCATGCGCTGCTGCGTGAGACGCACTATGATTTTCACGCCGAAACCAAG
GGCCCGGCAGGCTATGAGGCTGCCCGAGATATCCGGCACTACATTGAGCGTTCCACCGACACTTTTGCCTACTTT
CTTGCCCAAGAGGCCGTGGACGGCGACGGCGACAAGGAAAAGGACAGGAACAAGAGCGAGGATGAGCAGAGACGG
CAGCGAGGCAGTCACCTTGTAGTCGTCTTGCAACAGGATGGCGTCTTTCGCACAAACTGTCTGGATTGCCTCGAC
CGCACCAACCTGATTCAGACGCTGATTTCGCAAATGGCCATTGAGACCTTCCTCGCCCACCGCAACGAGTATGCA
GCGTCAGACTTTTGGATGCGGCATGCCAGCCTCTGGGCCGACAATGGCGATTCGCTCTCCAAGATATACGCCGGG
ACGGGTGCACTCAAGTCGTCGTTTACGCGGCACGGCAAGATGTCACTGGCCGGCGCAGTGGCCGACATGCGCAAG
TCGGTCCAGCGAATCTACCACAACAACTTTATTGATCCTTCGCGACAAGTCACGATTGACATGTTACTCGGCCGA
CTCATTGGCCAGGCAGCCGTGCTCCTCTACGACCCCATTAGCGACTATGTCTCAGTCGAGGTGGCTCGGCGTAGC
GACGAGTACACATCCTTTGAGAAGATTAGCATCTGGGCTGGCACTTTTAACCTCAACGGACGCACCCAGGGCATC
GATAAGGATCTTTCGCCCTGGCTTCTGCCCCGGTCCTTGGATGCCGACCTTGCTGATGTCTACGTTGTTGCCTTT
CAGGAAATCGTCGAGCTCAGCCCCCAGCAGATTATGAACAGTGACCCGTCGCGGCGACACTTGTGGGAGAGCGCC
GTCAAGCATTGCCTCAATCGACGGCAGGCGAGCAGAGGAGGAGTCAAGTATGTGCTCCTACGCAGCGGACAGCTC
GTTGGTGCCGCCCTCTGTATCTTTGTCAGAGCGTCGGTTCTCTGCCACATCAAGAACGTCGAGGGCAGCGTCAAG
AAGACAGGACTGTCGGGAATGGCTGGCAACAAGGGAGCCGTTGCCATCCGCTTTGACTTTGCCAACACTCATGTC
TGCTTTGTCACGGCGCACCTGGCAGCTGGCTTCTCCAACTATGAGGAAAGAAATCGCGACTATGCCACCATTCAC
GAGGGGTTGCGTTTCCAGCGCAACAGGGGAATAGAGGACCATGATGCAATCATATGGCTTGGAGACTTCAATTAC
CGCATCGGACTTGCTCTTGAGGCTACCCGGGCCCTGATGAAGAGAGGCGACTTGGGAACGCTCTACGAAAACGAT
CAGCTGAATCTCCAGATGGTGGCGGGGCTGGCCTTTCACTTTTACTCGGAAGCACGCATCAGCTTCATGCCAACG
TACAAATTTGATGTTGGGACCGACGACTACGACACGTCGGAGAAGGCTCGAATACCGGCATGGACGGACAGAATC
TTGAAAAAGGGAGCCATACTACGACAGCTGTCGTACGAGTCGGCGCCACTGAGATTTTCTGACCACCGGCCAGTG
TATGCGTCGTTTGAATGCAAAGTAAGCATTGTGGACGAGACTCTGCGTGAAAAGATTAGCCAAGAGTCGTACCAG
CGACGCAAAGCTGAACTTGGGGATACTACGGCCCACGTGGGCGAGGACCAAGAAACAGAGGACGAAGACCTGATT
GGCTACGATGCCATCGAGCCCGGTCTCCCGCCAGCCAGCTCAGACAAGCACAAATGGTGGCTGGACCATGGGCAG
CCAGCGCGGGCGCACGTCATGGCTCCCAGCGGGAGTGACGGACAGTGCATGGCTCTCAACCCGCAGCGGCCTTCG
AACCCGTTTGGAGCTGGCGACGAGCCCGACTGGGTGTCTGTGCGGCGTCTTTCCGTCTCGAGTCTATCGAGCTCA
ACGTACGAAAAGGTGCCGCTCCCGCCGCGGCCTGGCGGACCGGCAACGGGAAGGCCAGATGATGTTGAGCATGGC
GAGGCGGCAATGCAGCCATGCGGGACTCGAGGACAACAAGGGCGGCCGGCGCCGCCACCGCCACCTCGGATGGGT
GCGCGGGCAGGACCGCTAGACAGTGCAATCAAGCAGCAAAGAGCGGCGGAGACGGGCAGCAAGAGCCCAAGCGCA
AGGCTGCCGGCGCCGCCTGTGGCAAAGAAGCCAGCTCATCTACTGGCTACAAAGGCACGGGCAAAGAACAAGACG
CCTGCAGCGACTGGTGCAGCTACGGCGGCAGTGGCGGCGGCGGCGGCGGCGGCGGCTGGTGCTGGTGCTGGTGCA
GGTGCTGGTGCTACAAGTGATATTGGTGCCAATAGCAATGGTGGGACAAGGACGGTGGCTCAGTTAGCGCCGGCG
TGGTCGAGAGCATCAGCCACGGCAGCGAGGCGAGGGGGACGAGATGGGCAGAAAACATGGCCAAGAGACGAGGAG
GCGGGCAATGGAGACGAGAGTCTGCTGGACTCGGCACTGGACGAGAGGCTTGGAGAGTCGATGCGGATTGGCGGA
TGGGAGGCGCTGCAGCCAAGCAAGAGCTGA
Transcript >OphauG2|5044
ATGGACGCCCAGCAGCCACCGCATACTTCGTGGGCCGCGCCTCCTCCCGCCCCGGAAAAGTCGAGCGAGCTGCTC
ATCCGCGACTATCCCCAGCGGTCCATTGCCATTGTGTCGTCGTCGCACGCTCTCATCTTGCGCTACAGCTCCTCG
GCGACGGAGACGCAGCACAATGGCTCCCACGCGTCTTTGGCATCGGCCCGATCGCGCACCGCCGAGTCGACTGTT
GCCAAGTGCATGGTGGAGTTTTCCCCCGTTTCGCAGCCGCTCCTTGCCCAGTACCGCCCACTTGCGCCACGGCCG
ATATACGGAACCTTGGGCCTCATGGCCGTTGACGGCCAAGTCTTCCTCTCCGTCATCACACGCGCCGTTAGGGCC
GCCACTGTCCGGCCCGGCGAGACGGTGGAGCGAATATCGAGCGTGGCCTTTTACTGCCTCAGCAGCGCAAATTAC
GACGACGTGGTCCCTCTGGAGCCCAGCGAGTCGGACATGTCCGAGGCCTCTTGGGCATATGGTAACGCTTCCTCG
TTTTACGGTCAGGGTCTCGGTAGGCGCGATGTGCCTCCCGAGCACCCGTGCCACGATTTACGCAAGCTGCTCAGC
AACGGCTCCTTTTATTATAGCACAGACTTCGACGTAACAAGCCGCCTGCAGGCAAGGCCCTTGAATACCAATTCT
TTTGAAATTGACAACTTTGATGACACGTACTTGTGGAACTCGTTCATGATCAGTCCACTTGTTCAGTTCCGCTCG
CGGCTCATGCCCCCCGAGCGCGAGGCCCTGGATTCGTCTCGCATTCTCACGTCGGCCATCCGAGGCTTCTGCAAA
ACCATGACAATACCACAGAGCTCGTCTCCCCTTGCATCAGGCTCTACAAGTGGAAAGCCGTCATATCTGACGCTC
ATATCGCGCCTGTCCTGCAGGCGAGCGGGGACTCGCTTCAACTCTCGAGGCATCGATGACGACGGGCACGTGGCC
AACTTTGTCGAGTCTGAGACGACGTTTTGGAGCCCAGTTGGCGTCTTGTTTTCCTATGCGCAAGTCAGAGGGTCA
GTGCCCGTGTTTTGGGAACAGACTGCCGAGCTGCTGCCAGGGAGGCAGAAAATCACCATCACCAGGTCGTCCGAG
GGCACGCAGCCAGTCCTGAACAAGCACTTTGAGGAACTCGAGCACATTTACGGCGCCGTCCACATCATCAACCTT
CTCAGCGAGACCAAGCCGGCCGAGATGGAGCTGAGCAGGCTGTATCGACAGGGCGTGCGCAACTGTCCATTGAGT
CGGCCTGGCGTCGACGCATCACCAGACCATGCGCTGCTGCGTGAGACGCACTATGATTTTCACGCCGAAACCAAG
GGCCCGGCAGGCTATGAGGCTGCCCGAGATATCCGGCACTACATTGAGCGTTCCACCGACACTTTTGCCTACTTT
CTTGCCCAAGAGGCCGTGGACGGCGACGGCGACAAGGAAAAGGACAGGAACAAGAGCGAGGATGAGCAGAGACGG
CAGCGAGGCAGTCACCTTGTAGTCGTCTTGCAACAGGATGGCGTCTTTCGCACAAACTGTCTGGATTGCCTCGAC
CGCACCAACCTGATTCAGACGCTGATTTCGCAAATGGCCATTGAGACCTTCCTCGCCCACCGCAACGAGTATGCA
GCGTCAGACTTTTGGATGCGGCATGCCAGCCTCTGGGCCGACAATGGCGATTCGCTCTCCAAGATATACGCCGGG
ACGGGTGCACTCAAGTCGTCGTTTACGCGGCACGGCAAGATGTCACTGGCCGGCGCAGTGGCCGACATGCGCAAG
TCGGTCCAGCGAATCTACCACAACAACTTTATTGATCCTTCGCGACAAGTCACGATTGACATGTTACTCGGCCGA
CTCATTGGCCAGGCAGCCGTGCTCCTCTACGACCCCATTAGCGACTATGTCTCAGTCGAGGTGGCTCGGCGTAGC
GACGAGTACACATCCTTTGAGAAGATTAGCATCTGGGCTGGCACTTTTAACCTCAACGGACGCACCCAGGGCATC
GATAAGGATCTTTCGCCCTGGCTTCTGCCCCGGTCCTTGGATGCCGACCTTGCTGATGTCTACGTTGTTGCCTTT
CAGGAAATCGTCGAGCTCAGCCCCCAGCAGATTATGAACAGTGACCCGTCGCGGCGACACTTGTGGGAGAGCGCC
GTCAAGCATTGCCTCAATCGACGGCAGGCGAGCAGAGGAGGAGTCAAGTATGTGCTCCTACGCAGCGGACAGCTC
GTTGGTGCCGCCCTCTGTATCTTTGTCAGAGCGTCGGTTCTCTGCCACATCAAGAACGTCGAGGGCAGCGTCAAG
AAGACAGGACTGTCGGGAATGGCTGGCAACAAGGGAGCCGTTGCCATCCGCTTTGACTTTGCCAACACTCATGTC
TGCTTTGTCACGGCGCACCTGGCAGCTGGCTTCTCCAACTATGAGGAAAGAAATCGCGACTATGCCACCATTCAC
GAGGGGTTGCGTTTCCAGCGCAACAGGGGAATAGAGGACCATGATGCAATCATATGGCTTGGAGACTTCAATTAC
CGCATCGGACTTGCTCTTGAGGCTACCCGGGCCCTGATGAAGAGAGGCGACTTGGGAACGCTCTACGAAAACGAT
CAGCTGAATCTCCAGATGGTGGCGGGGCTGGCCTTTCACTTTTACTCGGAAGCACGCATCAGCTTCATGCCAACG
TACAAATTTGATGTTGGGACCGACGACTACGACACGTCGGAGAAGGCTCGAATACCGGCATGGACGGACAGAATC
TTGAAAAAGGGAGCCATACTACGACAGCTGTCGTACGAGTCGGCGCCACTGAGATTTTCTGACCACCGGCCAGTG
TATGCGTCGTTTGAATGCAAAGTAAGCATTGTGGACGAGACTCTGCGTGAAAAGATTAGCCAAGAGTCGTACCAG
CGACGCAAAGCTGAACTTGGGGATACTACGGCCCACGTGGGCGAGGACCAAGAAACAGAGGACGAAGACCTGATT
GGCTACGATGCCATCGAGCCCGGTCTCCCGCCAGCCAGCTCAGACAAGCACAAATGGTGGCTGGACCATGGGCAG
CCAGCGCGGGCGCACGTCATGGCTCCCAGCGGGAGTGACGGACAGTGCATGGCTCTCAACCCGCAGCGGCCTTCG
AACCCGTTTGGAGCTGGCGACGAGCCCGACTGGGTGTCTGTGCGGCGTCTTTCCGTCTCGAGTCTATCGAGCTCA
ACGTACGAAAAGGTGCCGCTCCCGCCGCGGCCTGGCGGACCGGCAACGGGAAGGCCAGATGATGTTGAGCATGGC
GAGGCGGCAATGCAGCCATGCGGGACTCGAGGACAACAAGGGCGGCCGGCGCCGCCACCGCCACCTCGGATGGGT
GCGCGGGCAGGACCGCTAGACAGTGCAATCAAGCAGCAAAGAGCGGCGGAGACGGGCAGCAAGAGCCCAAGCGCA
AGGCTGCCGGCGCCGCCTGTGGCAAAGAAGCCAGCTCATCTACTGGCTACAAAGGCACGGGCAAAGAACAAGACG
CCTGCAGCGACTGGTGCAGCTACGGCGGCAGTGGCGGCGGCGGCGGCGGCGGCGGCTGGTGCTGGTGCTGGTGCA
GGTGCTGGTGCTACAAGTGATATTGGTGCCAATAGCAATGGTGGGACAAGGACGGTGGCTCAGTTAGCGCCGGCG
TGGTCGAGAGCATCAGCCACGGCAGCGAGGCGAGGGGGACGAGATGGGCAGAAAACATGGCCAAGAGACGAGGAG
GCGGGCAATGGAGACGAGAGTCTGCTGGACTCGGCACTGGACGAGAGGCTTGGAGAGTCGATGCGGATTGGCGGA
TGGGAGGCGCTGCAGCCAAGCAAGAGCTGA
Gene >OphauG2|5044
ATGGACGCCCAGCAGCCACCGCATACTTCGTGGGCCGCGCCTCCTCCCGCCCCGGAAAAGTCGAGCGAGCTGCTC
ATCCGCGACTATCCCCAGCGGTCCATTGCCATTGTGTCGTCGTCGCACGCTCTCATCTTGCGCTACAGCTCCTCG
GCGACGGAGACGCAGCACAATGGCTCCCACGCGTCTTTGGCATCGGCCCGATCGCGCACCGCCGAGTCGACTGTT
GCCAAGTGCATGGTGGAGTTTTCCCCCGTTTCGCAGCCGCTCCTTGCCCAGTACCGCCCACTTGCGCCACGGCCG
ATATACGGAACCTTGGGCCTCATGGCCGTTGACGGCCAAGTCTTCCTCTCCGTCATCACACGCGCCGTTAGGGCC
GCCACTGTCCGGCCCGGCGAGACGGTGGAGCGAATATCGAGCGTGGCCTTTTACTGCCTCAGCAGCGCAAATTAC
GACGACGTGGTCCCTCTGGAGCCCAGCGAGTCGGACATGTCCGAGGCCTCTTGGGCATATGGTAACGCTTCCTCG
TTTTACGGTCAGGGTCTCGGTAGGCGCGATGTGCCTCCCGAGCACCCGTGCCACGATTTACGCAAGCTGCTCAGC
AACGGCTCCTTTTATTATAGCACAGACTTCGACGTAACAAGCCGCCTGCAGGCAAGGTAATGCCGTCATGGTCTC
GCCAAACCGTCTCTTGTTTGCTGACCATGACTGCCAAGGCCCTTGAATACCAATTCTTTTGAAATTGACAACTTT
GATGACACGTACTTGTGGAACTCGTTCATGATCAGTCCACTTGTTCAGTTCCGCTCGCGGCTCATGCCCCCCGAG
CGCGAGGCCCTGGATTCGTCTCGCATTCTCACGTCGGCCATCCGAGGCTTCTGCAAAACCATGACAATACCACAG
AGCTCGTCTCCCCTTGCATCAGGCTCTACAAGTGGAAAGCCGTCATATCTGACGCTCATATCGCGCCTGTCCTGC
AGGCGAGCGGGGACTCGCTTCAACTCTCGAGGCATCGATGACGACGGGCACGTGGCCAACTTTGTCGAGTCTGAG
ACGACGTTTTGGAGCCCAGTTGGCGTCTTGTTTTCCTATGCGCAAGTCAGAGGGTCAGTGCCCGTGTTTTGGGAA
CAGACTGCCGAGCTGCTGCCAGGGAGGCAGAAAATCACCATCACCAGGTCGTCCGAGGGCACGCAGCCAGTCCTG
AACAAGCACTTTGAGGAACTCGAGCACATTTACGGCGCCGTCCACATCATCAACCTTCTCAGCGAGACCAAGCCG
GCCGAGATGGAGCTGAGCAGGCTGTATCGACAGGGCGTGCGCAACTGTCCATTGAGTCGGCCTGGCGTCGACGCA
TCACCAGACCATGCGCTGCTGCGTGAGACGCACTATGATTTTCACGCCGAAACCAAGGGCCCGGCAGGCTATGAG
GCTGCCCGAGATATCCGGCACTACATTGAGCGTTCCACCGACACTTTTGCCTACTTTCTTGCCCAAGAGGCCGTG
GACGGCGACGGCGACAAGGAAAAGGACAGGAACAAGAGCGAGGATGAGCAGAGACGGCAGCGAGGCAGTCACCTT
GTAGTCGTCTTGCAACAGGATGGCGTCTTTCGCACAAACTGTCTGGATTGCCTCGACCGCACCAACCTGATTCAG
ACGCTGATTTCGCAAATGGCCATTGAGACCTTCCTCGCCCACCGCAACGAGTATGCAGCGTCAGACTTTTGGATG
CGGCATGCCAGCCTCTGGGCCGACAATGGCGATTCGCTCTCCAAGATATACGCCGGGACGGGTGCACTCAAGTCG
TCGTTTACGCGGCACGGCAAGATGTCACTGGCCGGCGCAGTGGCCGACATGCGCAAGTCGGTCCAGCGAATCTAC
CACAACAACTTTATTGATCCTTCGCGACAAGTCACGATTGACATGTTACTCGGCCGACTCATTGGCCAGGCAGCC
GTGCTCCTCTACGACCCCATTAGCGACTATGTCTCAGTCGAGGTGGCTCGGCGTAGCGACGAGTACACATCCTTT
GAGAAGATTAGCATCTGGGCTGGCACTTTTAACCTCAACGGACGCACCCAGGGCATCGATAAGGATCTTTCGCCC
TGGCTTCTGCCCCGGTCCTTGGATGCCGACCTTGCTGATGTCTACGTTGTTGCCTTTCAGGAAATCGTCGAGCTC
AGCCCCCAGCAGATTATGAACAGTGACCCGTCGCGGCGACACTTGTGGGAGAGCGCCGTCAAGCATTGCCTCAAT
CGACGGCAGGCGAGCAGAGGAGGAGTCAAGTATGTGCTCCTACGCAGCGGACAGCTCGTTGGTGCCGCCCTCTGT
ATCTTTGTCAGAGCGTCGGTTCTCTGCCACATCAAGAACGTCGAGGGCAGCGTCAAGAAGACAGGACTGTCGGGA
ATGGCTGGCAACAAGGGAGCCGTTGCCATCCGCTTTGACTTTGCCAACACTCATGTCTGCTTTGTCACGGCGCAC
CTGGCAGCTGGCTTCTCCAACTATGAGGAAAGAAATCGCGACTATGCCACCATTCACGAGGGGTTGCGTTTCCAG
CGCAACAGGGGAATAGAGGACCATGGTAAGCCTTGGACAGGGCGAGGGCGCATTGGGACTGTCTGCTAAAGTAGC
TGCGTGGGTAGATGCAATCATATGGCTTGGAGACTTCAATTACCGCATCGGACTTGCTCTTGAGGCTACCCGGGC
CCTGATGAAGAGAGGCGACTTGGGAACGCTCTACGAAAACGATCAGCTGAATCTCCAGATGGTGGCGGGGCTGGC
CTTTCACTTTTACTCGGAAGCACGCATCAGCTTCATGCCAACGTACAAATTTGATGTTGGGACCGACGACTACGA
CACGTCGTGAGTCTGGGCACCACCACATGCGAGAGAGACGACACGGGCTGACAGCAGGCATTATCAGGGAGAAGG
CTCGAATACCGGCATGGACGGACAGAATCTTGAAAAAGGGAGCCATACTACGACAGCTGTCGTACGAGTCGGCGC
CACTGAGATTTTCTGACCACCGGCCAGTGTATGCGTCGTTTGAATGCAAAGTAAGCATTGTGGACGAGACTCTGC
GTGAAAAGATTAGCCAAGAGTCGTACCAGCGACGCAAAGCTGAACTTGGGGATACTACGGCCCACGTGGGCGAGG
ACCAAGAAACAGAGGACGAAGACCTGATTGGCTACGATGCCATCGAGCCCGGTCTCCCGCCAGCCAGCTCAGACA
AGCACAAATGGTGGCTGGACCATGGGCAGCCAGCGCGGGCGCACGTCATGGCTCCCAGCGGGAGTGACGGACAGT
GCATGGCTCTCAACCCGCAGCGGCCTTCGAACCCGTTTGGAGCTGGCGACGAGCCCGACTGGGTGTCTGTGCGGC
GTCTTTCCGTCTCGAGTCTATCGAGCTCAACGTACGAAAAGGTGCCGCTCCCGCCGCGGCCTGGCGGACCGGCAA
CGGGAAGGCCAGATGATGTTGAGCATGGCGAGGCGGCAATGCAGCCATGCGGGACTCGAGGACAACAAGGGCGGC
CGGCGCCGCCACCGCCACCTCGGATGGGTGCGCGGGCAGGACCGCTAGACAGTGCAATCAAGCAGCAAAGAGCGG
CGGAGACGGGCAGCAAGAGCCCAAGCGCAAGGCTGCCGGCGCCGCCTGTGGCAAAGAAGCCAGCTCATCTACTGG
CTACAAAGGCACGGGCAAAGAACAAGACGCCTGCAGCGACTGGTGCAGCTACGGCGGCAGTGGCGGCGGCGGCGG
CGGCGGCGGCTGGTGCTGGTGCTGGTGCAGGTGCTGGTGCTACAAGTGATATTGGTGCCAATAGCAATGGTGGGA
CAAGGACGGTGGCTCAGTTAGCGCCGGCGTGGTCGAGAGCATCAGCCACGGCAGCGAGGCGAGGGGGACGAGATG
GGCAGAAAACATGGCCAAGAGACGAGGAGGCGGGCAATGGAGACGAGAGTCTGCTGGACTCGGCACTGGACGAGA
GGCTTGGAGAGTCGATGCGGATTGGCGGATGGGAGGCGCTGCAGCCAAGCAAGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail