Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5034
Gene name
LocationContig_444:150..3472
Strand-
Gene length (bp)3322
Transcript length (bp)3225
Coding sequence length (bp)3225
Protein length (aa) 1075

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.7E-10 970 1042

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006468 protein phosphorylation Yes
GO:0004672 protein kinase activity Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0030554 adenyl nucleotide binding No
GO:0016301 kinase activity No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016310 phosphorylation No
GO:0006793 phosphorus metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0019538 protein metabolic process No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup117
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1568
Ophiocordyceps australis 1348a (Ghana) OphauG2|5034 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4034
Ophiocordyceps camponoti-floridani Ophcf2|00717
Ophiocordyceps camponoti-floridani Ophcf2|06855
Ophiocordyceps camponoti-rufipedis Ophun1|2681
Ophiocordyceps camponoti-rufipedis Ophun1|3369
Ophiocordyceps kimflemingae Ophio5|1993
Ophiocordyceps kimflemingae Ophio5|2077
Ophiocordyceps kimflemingae Ophio5|6199
Ophiocordyceps kimflemingae Ophio5|7935
Ophiocordyceps subramaniannii Hirsu2|3551
Ophiocordyceps subramaniannii Hirsu2|3569
Ophiocordyceps subramaniannii Hirsu2|7031

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5034
MDTELLKAVQEQLRQVQKQLADSEARHDEERKSLREETKSLRKETETIQARHALEMEKRDRQSQERRARDAREME
ERDRQSQERRARHAREMEELDRQSEERRARHALEMEKLKREYQEKTRERDRQSQERKAREAREMEERKAREAREI
EERQARHALEMEERQARHALEMEKQKREYEEKTRERDRQSQERKARDAREMEERQARHALEMEKRDREYQEKTRE
RDRQSQERKARDAREMEERQARHALEMEKRDREYQEKTRERDRQSQERKARDAREMEERNREYEEKAQEQARVRQ
EQIDELVRQLEKQKLESKERDRQSQEEQARVRKEQIDELVRQLEKQKLESKERDRELREMKETHRLSTLPEYTLL
CQDAYSKMRIEPNPSLLSKGTVTSPVHKLCPTSLRKWVDFLDIQKSILGQFVAMFPSEKHFFDSRGFTTRLGESI
LSKPIADEKGLEKFLSLAIERPVTAILAESKKLTALNQLFGLGDGLQFENHPHALSDASDEVAERAPAPRPITPP
SQTADNSQIRPDQICIYLSKSGHRRMAFVCEYKAPHKLTEQDLRVGLHEMNVHKDVANRKTKLPPQEQPEARFKF
NAERLAASALTQTYHYMIHSGLEYGLIATGRAIVFLKIDWQCPWTLFYHLSEPTPETMSHPGNVQSCSVISQYVA
FCLLAMSKGRVHPQNVREDFMEVSKRWSEDFEATIASIHLEDRTAPPGSSAYVPTTYSTVDRTPPVTRSRPIMVA
NPFCRPPLAGEPSDNYSDDEENGPGAFPDTPCPTDHGSGRSRGIRRSARIHAQGSKSHEAKKPADNEYCTQKCLL
GLVNGRELDPRCPNVAAHRAKSTSSRHPVTHTVWLKSLSEQLRRDLDDGVVKLEKEGSYGVLFKIIHLELGYTFV
AKGTIAAYTGEIKHEAAIYDQLRPVQGLSIPVYLGSLDLRTVKRTYYYDHRVYIIYLMFLSWAGDRFQTLPTPEQ
KGKVMGRIQRCVRTLHKHGVVHRDLRLPNILYNAEARRIMIVDFGRAAVLQEARPALASRSANRQSRGPETDKKL
KEPSNKERLRDWLELDIAYTTSMF*
Coding >OphauG2|5034
ATGGACACAGAACTTCTCAAGGCTGTGCAAGAGCAGCTGCGTCAGGTTCAGAAGCAGCTTGCTGACTCAGAGGCG
CGTCATGACGAAGAAAGAAAGTCTCTGAGGGAAGAAACAAAGAGTCTGAGGAAAGAAACTGAGACTATACAGGCG
CGCCATGCCCTAGAAATGGAAAAACGGGACCGCCAAAGCCAAGAAAGGCGGGCACGCGATGCCCGAGAAATGGAA
GAACGGGACCGCCAAAGCCAAGAAAGGCGGGCGCGCCATGCCCGAGAAATGGAAGAACTAGACCGCCAAAGCGAA
GAAAGGCGGGCGCGCCATGCCCTAGAAATGGAAAAACTGAAACGCGAATACCAAGAAAAGACGCGAGAACGGGAC
CGCCAAAGCCAAGAAAGGAAGGCTCGCGAGGCCCGAGAAATGGAAGAAAGGAAGGCTCGCGAGGCCCGAGAAATA
GAAGAAAGACAGGCGCGCCATGCCCTAGAAATGGAAGAAAGACAGGCGCGCCATGCCCTAGAAATGGAAAAACAG
AAACGCGAATATGAAGAAAAGACGCGAGAACGGGACCGCCAAAGCCAAGAGAGGAAGGCGCGCGATGCCCGAGAA
ATGGAAGAAAGACAGGCGCGCCATGCCCTAGAAATGGAAAAACGGGACCGTGAATATCAAGAAAAGACGCGAGAA
CGGGACCGCCAAAGCCAAGAGAGGAAGGCGCGCGATGCCCGAGAAATGGAAGAAAGACAGGCGCGCCATGCCCTA
GAAATGGAAAAACGGGACCGTGAATATCAAGAAAAGACGCGAGAACGGGACCGCCAAAGCCAAGAAAGGAAGGCG
CGAGATGCCCGAGAAATGGAAGAACGGAACCGCGAATACGAAGAAAAGGCACAAGAGCAAGCCAGAGTAAGACAA
GAACAGATTGACGAGCTAGTTCGGCAACTTGAGAAACAGAAACTTGAGAGTAAAGAACGGGACCGCCAAAGCCAA
GAAGAGCAAGCCAGAGTAAGAAAAGAACAGATTGACGAGCTCGTTCGGCAACTTGAGAAACAGAAACTTGAGAGT
AAAGAACGGGACCGCGAACTTCGGGAGATGAAGGAAACTCACCGTCTCTCAACATTGCCCGAATACACTCTGCTA
TGCCAGGATGCTTACTCCAAGATGAGGATTGAGCCAAACCCCTCCCTATTGTCCAAAGGCACTGTTACCAGCCCA
GTCCATAAACTTTGCCCAACCAGTCTTCGGAAATGGGTCGACTTTCTCGACATCCAAAAGTCGATTCTCGGGCAA
TTTGTGGCCATGTTTCCTAGTGAGAAACATTTCTTTGACAGTCGTGGCTTTACTACACGTCTAGGCGAGTCCATC
CTATCGAAACCAATCGCAGACGAAAAAGGCCTCGAAAAGTTTCTCAGTCTTGCTATTGAGCGCCCTGTAACCGCA
ATCTTGGCGGAATCCAAAAAATTGACAGCCTTGAACCAACTCTTTGGACTTGGAGATGGTCTCCAGTTTGAAAAT
CATCCTCATGCACTCAGCGACGCCTCTGACGAAGTTGCCGAACGCGCTCCGGCTCCACGTCCAATCACTCCTCCC
AGTCAGACGGCGGATAATAGCCAGATTCGCCCGGATCAAATTTGCATCTATTTATCCAAATCTGGACACCGACGA
ATGGCTTTTGTTTGCGAATACAAGGCGCCTCACAAGTTGACGGAACAAGACCTTCGTGTCGGTCTGCATGAGATG
AATGTTCACAAGGATGTTGCTAATCGCAAAACCAAACTGCCACCTCAGGAACAACCAGAAGCCCGCTTCAAATTT
AACGCAGAGAGACTCGCAGCGTCTGCCTTGACCCAGACATATCATTACATGATCCACAGTGGCCTCGAATATGGC
CTCATTGCTACAGGCAGGGCCATCGTCTTTCTCAAGATTGATTGGCAATGCCCTTGGACTCTTTTCTACCATTTG
TCAGAGCCTACGCCCGAAACTATGAGCCATCCAGGCAATGTTCAGTCTTGTTCCGTCATTAGCCAATACGTGGCA
TTTTGCCTTTTGGCAATGTCCAAGGGACGTGTCCATCCCCAGAATGTACGTGAGGATTTCATGGAGGTGTCCAAG
AGATGGTCAGAAGATTTCGAGGCAACTATAGCATCCATCCATCTCGAGGACCGGACAGCGCCCCCGGGATCGTCG
GCATATGTGCCAACAACTTACTCTACCGTTGACCGCACGCCTCCAGTGACGCGTTCGCGCCCCATTATGGTGGCA
AACCCGTTTTGCCGGCCCCCTTTAGCCGGAGAGCCTTCGGACAACTACTCGGACGATGAGGAAAATGGCCCTGGA
GCTTTTCCTGATACGCCGTGTCCCACTGACCATGGCTCAGGTCGGTCTCGGGGCATTCGGCGCAGTGCTCGTATC
CATGCTCAAGGTTCCAAGAGCCACGAAGCCAAAAAGCCTGCAGATAACGAATACTGCACCCAGAAGTGTTTGCTT
GGCCTGGTAAATGGCAGGGAACTGGATCCCCGCTGCCCCAATGTGGCCGCTCATCGCGCCAAGAGTACGAGCTCG
CGCCATCCCGTCACGCATACAGTCTGGCTCAAGAGCCTCTCTGAGCAATTGCGGCGCGACTTAGATGACGGCGTC
GTCAAACTCGAAAAGGAAGGGTCATACGGGGTGCTGTTTAAGATTATTCATCTTGAGCTGGGCTATACCTTTGTC
GCAAAGGGCACGATTGCTGCTTACACCGGGGAGATTAAGCACGAGGCTGCAATCTACGACCAGCTTCGCCCGGTA
CAGGGACTCTCGATTCCCGTCTATCTCGGCTCTCTCGACCTAAGAACGGTCAAGAGAACATACTACTACGACCAC
CGCGTCTACATCATCTATCTCATGTTTCTCTCATGGGCTGGTGATCGTTTCCAGACACTCCCCACCCCAGAGCAA
AAGGGCAAGGTGATGGGTCGGATTCAACGATGTGTGCGAACCCTGCACAAACACGGAGTCGTGCATCGAGACTTG
CGCCTGCCCAATATTTTGTATAATGCCGAGGCTCGCCGAATCATGATTGTTGACTTTGGGCGCGCTGCGGTTTTG
CAAGAGGCTCGGCCAGCTCTGGCTTCGAGGTCGGCTAATAGACAATCTCGCGGGCCGGAGACGGATAAGAAGCTA
AAGGAACCGTCCAACAAGGAGCGACTCAGGGATTGGTTGGAACTTGACATTGCTTATACAACTTCTATGTTTTGA
Transcript >OphauG2|5034
ATGGACACAGAACTTCTCAAGGCTGTGCAAGAGCAGCTGCGTCAGGTTCAGAAGCAGCTTGCTGACTCAGAGGCG
CGTCATGACGAAGAAAGAAAGTCTCTGAGGGAAGAAACAAAGAGTCTGAGGAAAGAAACTGAGACTATACAGGCG
CGCCATGCCCTAGAAATGGAAAAACGGGACCGCCAAAGCCAAGAAAGGCGGGCACGCGATGCCCGAGAAATGGAA
GAACGGGACCGCCAAAGCCAAGAAAGGCGGGCGCGCCATGCCCGAGAAATGGAAGAACTAGACCGCCAAAGCGAA
GAAAGGCGGGCGCGCCATGCCCTAGAAATGGAAAAACTGAAACGCGAATACCAAGAAAAGACGCGAGAACGGGAC
CGCCAAAGCCAAGAAAGGAAGGCTCGCGAGGCCCGAGAAATGGAAGAAAGGAAGGCTCGCGAGGCCCGAGAAATA
GAAGAAAGACAGGCGCGCCATGCCCTAGAAATGGAAGAAAGACAGGCGCGCCATGCCCTAGAAATGGAAAAACAG
AAACGCGAATATGAAGAAAAGACGCGAGAACGGGACCGCCAAAGCCAAGAGAGGAAGGCGCGCGATGCCCGAGAA
ATGGAAGAAAGACAGGCGCGCCATGCCCTAGAAATGGAAAAACGGGACCGTGAATATCAAGAAAAGACGCGAGAA
CGGGACCGCCAAAGCCAAGAGAGGAAGGCGCGCGATGCCCGAGAAATGGAAGAAAGACAGGCGCGCCATGCCCTA
GAAATGGAAAAACGGGACCGTGAATATCAAGAAAAGACGCGAGAACGGGACCGCCAAAGCCAAGAAAGGAAGGCG
CGAGATGCCCGAGAAATGGAAGAACGGAACCGCGAATACGAAGAAAAGGCACAAGAGCAAGCCAGAGTAAGACAA
GAACAGATTGACGAGCTAGTTCGGCAACTTGAGAAACAGAAACTTGAGAGTAAAGAACGGGACCGCCAAAGCCAA
GAAGAGCAAGCCAGAGTAAGAAAAGAACAGATTGACGAGCTCGTTCGGCAACTTGAGAAACAGAAACTTGAGAGT
AAAGAACGGGACCGCGAACTTCGGGAGATGAAGGAAACTCACCGTCTCTCAACATTGCCCGAATACACTCTGCTA
TGCCAGGATGCTTACTCCAAGATGAGGATTGAGCCAAACCCCTCCCTATTGTCCAAAGGCACTGTTACCAGCCCA
GTCCATAAACTTTGCCCAACCAGTCTTCGGAAATGGGTCGACTTTCTCGACATCCAAAAGTCGATTCTCGGGCAA
TTTGTGGCCATGTTTCCTAGTGAGAAACATTTCTTTGACAGTCGTGGCTTTACTACACGTCTAGGCGAGTCCATC
CTATCGAAACCAATCGCAGACGAAAAAGGCCTCGAAAAGTTTCTCAGTCTTGCTATTGAGCGCCCTGTAACCGCA
ATCTTGGCGGAATCCAAAAAATTGACAGCCTTGAACCAACTCTTTGGACTTGGAGATGGTCTCCAGTTTGAAAAT
CATCCTCATGCACTCAGCGACGCCTCTGACGAAGTTGCCGAACGCGCTCCGGCTCCACGTCCAATCACTCCTCCC
AGTCAGACGGCGGATAATAGCCAGATTCGCCCGGATCAAATTTGCATCTATTTATCCAAATCTGGACACCGACGA
ATGGCTTTTGTTTGCGAATACAAGGCGCCTCACAAGTTGACGGAACAAGACCTTCGTGTCGGTCTGCATGAGATG
AATGTTCACAAGGATGTTGCTAATCGCAAAACCAAACTGCCACCTCAGGAACAACCAGAAGCCCGCTTCAAATTT
AACGCAGAGAGACTCGCAGCGTCTGCCTTGACCCAGACATATCATTACATGATCCACAGTGGCCTCGAATATGGC
CTCATTGCTACAGGCAGGGCCATCGTCTTTCTCAAGATTGATTGGCAATGCCCTTGGACTCTTTTCTACCATTTG
TCAGAGCCTACGCCCGAAACTATGAGCCATCCAGGCAATGTTCAGTCTTGTTCCGTCATTAGCCAATACGTGGCA
TTTTGCCTTTTGGCAATGTCCAAGGGACGTGTCCATCCCCAGAATGTACGTGAGGATTTCATGGAGGTGTCCAAG
AGATGGTCAGAAGATTTCGAGGCAACTATAGCATCCATCCATCTCGAGGACCGGACAGCGCCCCCGGGATCGTCG
GCATATGTGCCAACAACTTACTCTACCGTTGACCGCACGCCTCCAGTGACGCGTTCGCGCCCCATTATGGTGGCA
AACCCGTTTTGCCGGCCCCCTTTAGCCGGAGAGCCTTCGGACAACTACTCGGACGATGAGGAAAATGGCCCTGGA
GCTTTTCCTGATACGCCGTGTCCCACTGACCATGGCTCAGGTCGGTCTCGGGGCATTCGGCGCAGTGCTCGTATC
CATGCTCAAGGTTCCAAGAGCCACGAAGCCAAAAAGCCTGCAGATAACGAATACTGCACCCAGAAGTGTTTGCTT
GGCCTGGTAAATGGCAGGGAACTGGATCCCCGCTGCCCCAATGTGGCCGCTCATCGCGCCAAGAGTACGAGCTCG
CGCCATCCCGTCACGCATACAGTCTGGCTCAAGAGCCTCTCTGAGCAATTGCGGCGCGACTTAGATGACGGCGTC
GTCAAACTCGAAAAGGAAGGGTCATACGGGGTGCTGTTTAAGATTATTCATCTTGAGCTGGGCTATACCTTTGTC
GCAAAGGGCACGATTGCTGCTTACACCGGGGAGATTAAGCACGAGGCTGCAATCTACGACCAGCTTCGCCCGGTA
CAGGGACTCTCGATTCCCGTCTATCTCGGCTCTCTCGACCTAAGAACGGTCAAGAGAACATACTACTACGACCAC
CGCGTCTACATCATCTATCTCATGTTTCTCTCATGGGCTGGTGATCGTTTCCAGACACTCCCCACCCCAGAGCAA
AAGGGCAAGGTGATGGGTCGGATTCAACGATGTGTGCGAACCCTGCACAAACACGGAGTCGTGCATCGAGACTTG
CGCCTGCCCAATATTTTGTATAATGCCGAGGCTCGCCGAATCATGATTGTTGACTTTGGGCGCGCTGCGGTTTTG
CAAGAGGCTCGGCCAGCTCTGGCTTCGAGGTCGGCTAATAGACAATCTCGCGGGCCGGAGACGGATAAGAAGCTA
AAGGAACCGTCCAACAAGGAGCGACTCAGGGATTGGTTGGAACTTGACATTGCTTATACAACTTCTATGTTTTGA
Gene >OphauG2|5034
ATGGACACAGAACTTCTCAAGGCTGTGCAAGAGCAGCTGCGTCAGGTTCAGAAGCAGCTTGCTGACTCAGAGGTA
TGATGCGTATCAAGATTGGGATGATTTAAAAGGACATGCTATGAGTCGGAAGCGGAAAACAAAGTGCCCGAGAGG
AGACACTAACACTATACAGGCGCGTCATGACGAAGAAAGAAAGTCTCTGAGGGAAGAAACAAAGAGTCTGAGGAA
AGAAACTGAGACTATACAGGCGCGCCATGCCCTAGAAATGGAAAAACGGGACCGCCAAAGCCAAGAAAGGCGGGC
ACGCGATGCCCGAGAAATGGAAGAACGGGACCGCCAAAGCCAAGAAAGGCGGGCGCGCCATGCCCGAGAAATGGA
AGAACTAGACCGCCAAAGCGAAGAAAGGCGGGCGCGCCATGCCCTAGAAATGGAAAAACTGAAACGCGAATACCA
AGAAAAGACGCGAGAACGGGACCGCCAAAGCCAAGAAAGGAAGGCTCGCGAGGCCCGAGAAATGGAAGAAAGGAA
GGCTCGCGAGGCCCGAGAAATAGAAGAAAGACAGGCGCGCCATGCCCTAGAAATGGAAGAAAGACAGGCGCGCCA
TGCCCTAGAAATGGAAAAACAGAAACGCGAATATGAAGAAAAGACGCGAGAACGGGACCGCCAAAGCCAAGAGAG
GAAGGCGCGCGATGCCCGAGAAATGGAAGAAAGACAGGCGCGCCATGCCCTAGAAATGGAAAAACGGGACCGTGA
ATATCAAGAAAAGACGCGAGAACGGGACCGCCAAAGCCAAGAGAGGAAGGCGCGCGATGCCCGAGAAATGGAAGA
AAGACAGGCGCGCCATGCCCTAGAAATGGAAAAACGGGACCGTGAATATCAAGAAAAGACGCGAGAACGGGACCG
CCAAAGCCAAGAAAGGAAGGCGCGAGATGCCCGAGAAATGGAAGAACGGAACCGCGAATACGAAGAAAAGGCACA
AGAGCAAGCCAGAGTAAGACAAGAACAGATTGACGAGCTAGTTCGGCAACTTGAGAAACAGAAACTTGAGAGTAA
AGAACGGGACCGCCAAAGCCAAGAAGAGCAAGCCAGAGTAAGAAAAGAACAGATTGACGAGCTCGTTCGGCAACT
TGAGAAACAGAAACTTGAGAGTAAAGAACGGGACCGCGAACTTCGGGAGATGAAGGAAACTCACCGTCTCTCAAC
ATTGCCCGAATACACTCTGCTATGCCAGGATGCTTACTCCAAGATGAGGATTGAGCCAAACCCCTCCCTATTGTC
CAAAGGCACTGTTACCAGCCCAGTCCATAAACTTTGCCCAACCAGTCTTCGGAAATGGGTCGACTTTCTCGACAT
CCAAAAGTCGATTCTCGGGCAATTTGTGGCCATGTTTCCTAGTGAGAAACATTTCTTTGACAGTCGTGGCTTTAC
TACACGTCTAGGCGAGTCCATCCTATCGAAACCAATCGCAGACGAAAAAGGCCTCGAAAAGTTTCTCAGTCTTGC
TATTGAGCGCCCTGTAACCGCAATCTTGGCGGAATCCAAAAAATTGACAGCCTTGAACCAACTCTTTGGACTTGG
AGATGGTCTCCAGTTTGAAAATCATCCTCATGCACTCAGCGACGCCTCTGACGAAGTTGCCGAACGCGCTCCGGC
TCCACGTCCAATCACTCCTCCCAGTCAGACGGCGGATAATAGCCAGATTCGCCCGGATCAAATTTGCATCTATTT
ATCCAAATCTGGACACCGACGAATGGCTTTTGTTTGCGAATACAAGGCGCCTCACAAGTTGACGGAACAAGACCT
TCGTGTCGGTCTGCATGAGATGAATGTTCACAAGGATGTTGCTAATCGCAAAACCAAACTGCCACCTCAGGAACA
ACCAGAAGCCCGCTTCAAATTTAACGCAGAGAGACTCGCAGCGTCTGCCTTGACCCAGACATATCATTACATGAT
CCACAGTGGCCTCGAATATGGCCTCATTGCTACAGGCAGGGCCATCGTCTTTCTCAAGATTGATTGGCAATGCCC
TTGGACTCTTTTCTACCATTTGTCAGAGCCTACGCCCGAAACTATGAGCCATCCAGGCAATGTTCAGTCTTGTTC
CGTCATTAGCCAATACGTGGCATTTTGCCTTTTGGCAATGTCCAAGGGACGTGTCCATCCCCAGAATGTACGTGA
GGATTTCATGGAGGTGTCCAAGAGATGGTCAGAAGATTTCGAGGCAACTATAGCATCCATCCATCTCGAGGACCG
GACAGCGCCCCCGGGATCGTCGGCATATGTGCCAACAACTTACTCTACCGTTGACCGCACGCCTCCAGTGACGCG
TTCGCGCCCCATTATGGTGGCAAACCCGTTTTGCCGGCCCCCTTTAGCCGGAGAGCCTTCGGACAACTACTCGGA
CGATGAGGAAAATGGCCCTGGAGCTTTTCCTGATACGCCGTGTCCCACTGACCATGGCTCAGGTCGGTCTCGGGG
CATTCGGCGCAGTGCTCGTATCCATGCTCAAGGTTCCAAGAGCCACGAAGCCAAAAAGCCTGCAGATAACGAATA
CTGCACCCAGAAGTGTTTGCTTGGCCTGGTAAATGGCAGGGAACTGGATCCCCGCTGCCCCAATGTGGCCGCTCA
TCGCGCCAAGAGTACGAGCTCGCGCCATCCCGTCACGCATACAGTCTGGCTCAAGAGCCTCTCTGAGCAATTGCG
GCGCGACTTAGATGACGGCGTCGTCAAACTCGAAAAGGAAGGGTCATACGGGGTGCTGTTTAAGATTATTCATCT
TGAGCTGGGCTATACCTTTGTCGCAAAGGGCACGATTGCTGCTTACACCGGGGAGATTAAGCACGAGGCTGCAAT
CTACGACCAGCTTCGCCCGGTACAGGGACTCTCGATTCCCGTCTATCTCGGCTCTCTCGACCTAAGAACGGTCAA
GAGAACATACTACTACGACCACCGCGTCTACATCATCTATCTCATGTTTCTCTCATGGGCTGGTGATCGTTTCCA
GACACTCCCCACCCCAGAGCAAAAGGGCAAGGTGATGGGTCGGATTCAACGATGTGTGCGAACCCTGCACAAACA
CGGAGTCGTGCATCGAGACTTGCGCCTGCCCAATATTTTGTATAATGCCGAGGCTCGCCGAATCATGATTGTTGA
CTTTGGGCGCGCTGCGGTTTTGCAAGAGGCTCGGCCAGCTCTGGCTTCGAGGTCGGCTAATAGACAATCTCGCGG
GCCGGAGACGGATAAGAAGCTAAAGGAACCGTCCAACAAGGAGCGACTCAGGGATTGGTTGGAACTTGACATTGC
TTATACAACTTCTATGTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail