Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5031
Gene name
LocationContig_443:9561..11127
Strand+
Gene length (bp)1566
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08912|YO389_YEAST Uncharacterized protein YOR389W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR389W PE=1 SV=1 32 494 2.0E-21
sp|Q08989|YP277_YEAST Uncharacterized protein YPL277C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL277C PE=1 SV=1 32 212 2.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5031
MENLLVLLVALSAFVATATGHIQPDHESSKANAHRIFNAVHSATRQWGSSLIHNGFSFFPATMPRGTLTYHGSLD
SHSPTGPEWLAFEVEHAQIFAQAWLLNVVQSPVRDQKLLTKSSSVQHDLQGYLHTYQANRDLNLLYVDGMSAGKS
DLGTLDSQDLVLLAAHPHKTPNLSPIDEMFRAKHICELITSWGYDGFMRMEMGFEIIYCDFNNGLNLVGITPTAN
RASSGKAAYTTTPQWARAAAERYDGVGGDRIRLDFSSMVSGFFFPINVSSTDPHRPDLPRLGAAEASQLMDIKSH
LHTVSLRDRAYNTNWQAIVDMIVSRFTARFNLMASPRTCLQDFVHEIFVSTGTYHGITPTRRAGQEDEEKGNRTA
EAVELCTKHYLLPTHLDRQAWTLEDSLIHTAVETVTSDICNTLFLIRALMLDTDASLEDSVEHSHMIRSDVGLQG
ALQKGRQLLLDLRQRLSWPVFKKPPVCAVDEMILTPMWPIGDAEDFWHPDCQPLDKIVFNRGDYWREHDKI*
Coding >OphauG2|5031
ATGGAAAACTTGCTAGTCCTACTTGTTGCCTTGAGCGCTTTCGTGGCGACTGCTACTGGCCATATTCAGCCCGAC
CACGAGAGCTCCAAGGCAAACGCACATCGCATATTCAATGCCGTCCACTCAGCCACCCGCCAATGGGGCTCCTCT
CTCATTCACAATGGCTTCAGCTTCTTCCCTGCCACGATGCCCCGAGGAACTCTGACTTATCATGGGTCGCTTGAT
AGCCACAGCCCTACAGGCCCCGAGTGGCTTGCTTTTGAAGTCGAGCACGCTCAAATCTTTGCTCAGGCGTGGCTG
TTAAACGTCGTCCAATCACCAGTCAGAGACCAGAAGCTCTTGACCAAAAGCAGCTCAGTGCAACACGACTTGCAG
GGATATTTGCACACGTATCAAGCCAATCGCGACTTGAACCTACTCTACGTCGATGGCATGAGTGCTGGCAAATCA
GACCTGGGGACTCTGGATTCTCAGGATCTTGTTTTGCTCGCGGCGCATCCGCATAAAACGCCAAACTTGTCACCC
ATCGATGAGATGTTTAGAGCCAAACATATATGCGAATTGATTACAAGCTGGGGCTACGACGGGTTTATGCGTATG
GAGATGGGCTTTGAGATAATCTACTGCGACTTCAACAACGGGCTCAATCTCGTAGGCATAACTCCCACGGCCAAT
AGAGCGTCATCTGGAAAAGCTGCATACACCACGACGCCACAGTGGGCCAGAGCGGCGGCTGAGCGATATGATGGT
GTGGGCGGCGACAGAATTAGACTCGACTTTTCCTCCATGGTTTCTGGCTTCTTCTTTCCTATCAACGTGTCTAGC
ACTGATCCTCATCGCCCAGATCTGCCTCGATTGGGTGCAGCAGAGGCGAGCCAACTCATGGACATCAAGTCTCAT
CTCCATACAGTGTCACTTAGAGACAGGGCATATAATACCAATTGGCAGGCAATAGTTGACATGATTGTCTCACGG
TTTACCGCTCGCTTCAACTTGATGGCATCGCCACGGACATGTTTACAAGACTTTGTTCACGAAATTTTCGTGTCG
ACTGGCACATATCACGGCATAACGCCAACTCGACGTGCTGGCCAGGAAGATGAAGAAAAAGGCAACCGTACCGCC
GAGGCAGTGGAACTATGCACCAAGCACTACCTTTTACCAACACACCTGGATCGACAAGCCTGGACATTAGAAGAC
AGCCTCATTCATACAGCCGTCGAGACAGTCACATCAGACATCTGCAACACGCTGTTTCTCATTCGCGCCCTAATG
CTCGATACCGATGCAAGCCTTGAGGATTCAGTTGAGCACAGCCACATGATAAGAAGCGACGTTGGGTTACAGGGC
GCGCTTCAGAAGGGCCGCCAACTGTTGCTTGACCTCCGCCAAAGGCTATCCTGGCCAGTATTCAAGAAACCGCCG
GTTTGTGCTGTTGACGAAATGATTCTCACTCCCATGTGGCCAATAGGTGACGCGGAAGACTTTTGGCATCCGGAT
TGTCAGCCTCTGGATAAGATTGTGTTCAACAGAGGAGACTACTGGAGGGAGCACGACAAGATTTGA
Transcript >OphauG2|5031
ATGGAAAACTTGCTAGTCCTACTTGTTGCCTTGAGCGCTTTCGTGGCGACTGCTACTGGCCATATTCAGCCCGAC
CACGAGAGCTCCAAGGCAAACGCACATCGCATATTCAATGCCGTCCACTCAGCCACCCGCCAATGGGGCTCCTCT
CTCATTCACAATGGCTTCAGCTTCTTCCCTGCCACGATGCCCCGAGGAACTCTGACTTATCATGGGTCGCTTGAT
AGCCACAGCCCTACAGGCCCCGAGTGGCTTGCTTTTGAAGTCGAGCACGCTCAAATCTTTGCTCAGGCGTGGCTG
TTAAACGTCGTCCAATCACCAGTCAGAGACCAGAAGCTCTTGACCAAAAGCAGCTCAGTGCAACACGACTTGCAG
GGATATTTGCACACGTATCAAGCCAATCGCGACTTGAACCTACTCTACGTCGATGGCATGAGTGCTGGCAAATCA
GACCTGGGGACTCTGGATTCTCAGGATCTTGTTTTGCTCGCGGCGCATCCGCATAAAACGCCAAACTTGTCACCC
ATCGATGAGATGTTTAGAGCCAAACATATATGCGAATTGATTACAAGCTGGGGCTACGACGGGTTTATGCGTATG
GAGATGGGCTTTGAGATAATCTACTGCGACTTCAACAACGGGCTCAATCTCGTAGGCATAACTCCCACGGCCAAT
AGAGCGTCATCTGGAAAAGCTGCATACACCACGACGCCACAGTGGGCCAGAGCGGCGGCTGAGCGATATGATGGT
GTGGGCGGCGACAGAATTAGACTCGACTTTTCCTCCATGGTTTCTGGCTTCTTCTTTCCTATCAACGTGTCTAGC
ACTGATCCTCATCGCCCAGATCTGCCTCGATTGGGTGCAGCAGAGGCGAGCCAACTCATGGACATCAAGTCTCAT
CTCCATACAGTGTCACTTAGAGACAGGGCATATAATACCAATTGGCAGGCAATAGTTGACATGATTGTCTCACGG
TTTACCGCTCGCTTCAACTTGATGGCATCGCCACGGACATGTTTACAAGACTTTGTTCACGAAATTTTCGTGTCG
ACTGGCACATATCACGGCATAACGCCAACTCGACGTGCTGGCCAGGAAGATGAAGAAAAAGGCAACCGTACCGCC
GAGGCAGTGGAACTATGCACCAAGCACTACCTTTTACCAACACACCTGGATCGACAAGCCTGGACATTAGAAGAC
AGCCTCATTCATACAGCCGTCGAGACAGTCACATCAGACATCTGCAACACGCTGTTTCTCATTCGCGCCCTAATG
CTCGATACCGATGCAAGCCTTGAGGATTCAGTTGAGCACAGCCACATGATAAGAAGCGACGTTGGGTTACAGGGC
GCGCTTCAGAAGGGCCGCCAACTGTTGCTTGACCTCCGCCAAAGGCTATCCTGGCCAGTATTCAAGAAACCGCCG
GTTTGTGCTGTTGACGAAATGATTCTCACTCCCATGTGGCCAATAGGTGACGCGGAAGACTTTTGGCATCCGGAT
TGTCAGCCTCTGGATAAGATTGTGTTCAACAGAGGAGACTACTGGAGGGAGCACGACAAGATTTGA
Gene >OphauG2|5031
ATGGAAAACTTGCTAGTCCTACTTGTTGCCTTGAGCGCTTTCGTGGCGACTGCTACTGGCCATATTCAGCCCGAC
CACGAGAGCTCCAAGGCAAACGCACATCGCATATTCAATGCCGTCCACTCAGCCACCCGCCAATGGGGCTCCTCT
CTCATTCACAATGGCTTCAGCTTCTTCCCTGCCACGATGCCCCGAGGAACTCTGACTTATCATGGGTCGCTTGAT
AGCCACAGCCCTACAGGCCCCGAGTGGCTTGCTTTTGAAGTCGAGCACGCTCAAATCTTTGCTCAGGCGTGGCTG
TTAAACGTCGTCCAATCACCAGTCAGAGACCAGAAGCTCTTGACCAAAAGCAGCTCAGTGCAACACGACTTGCAG
GGATATTTGCACACGTATCAAGCCAATCGCGACTTGAACCTACTCTACGTCGATGGCATGAGTGCTGGCAAATCA
GACCTGGGGACTCTGGATTCTCAGGATCTTGTTTTGCTCGCGGCGCATCCGCATAAAACGCCAAACTTGTCACCC
ATCGATGAGATGTTTAGAGCCAAACATATATGCGAATTGATTACAAGCTGGGGCTACGACGGGTTTATGCGTATG
GAGATGGGCTTTGAGATAATCTACTGCGACTTCAACAACGGGCTCAATCTCGTAGGCATAACTCCCACGGCCAAT
AGAGCGTCATCTGGAAAAGCTGCATACACCACGACGCCACAGTGGGCCAGAGCGGCGGCTGAGCGATATGATGGT
GTGGGCGGCGACAGAATTAGACTCGACTTTTCCTCCATGGTTTCTGGCTTCTTCTTTCCTATCAACGTGTCTAGC
ACTGATCCTCATCGCCCAGATCTGCCTCGATTGGGTGCAGCAGAGGCGAGCCAACTCATGGACATCAAGTCTCAT
CTCCATACAGTGTCACTTAGAGACAGGGCATATAATACCAATTGGCAGGCAATAGTTGACATGATTGTCTCACGG
TTTACCGCTCGCTTCAACTTGATGGCATCGCCACGGACATGTTTACAAGACTTTGTTCACGAAATTTTCGTGTCG
ACTGGCACATATCACGGCATAACGCCAACTCGACGTGCTGGCCAGGAAGATGAAGAAAAAGGCAACCGTACCGCC
GAGGCAGTGGAACTATGCACCAAGCACTACCTTTTACCAACACACCTGGATCGACAAGCCTGGACATTAGAAGAC
AGCCTCATTCATACAGCCGTCGAGACAGTCACATCAGACATCTGCAACACGCTGTTTCTCATTCGCGCCCTAATG
CTCGATACCGATGCAAGCCTTGAGGATTCAGTTGAGCACAGCCACATGATAAGAAGCGACGTTGGGTTACAGGGC
GCGCTTCAGAAGGGCCGCCAACTGTTGCTTGACCTCCGCCAAAGGCTATCCTGGCCAGTATTCAAGAAACCGCCG
GTTTGTGCTGTTGACGAAATGATTCTCACTCCCATGTGGCCAATAGGTGACGCGGAAGACTTTTGGCATCCGGAT
TGTCAGCCTCTGGATAAGATTGTGTTCAACAGAGGAGACTACTGGAGGGAGCACGACAAGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail