Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5016
Gene name
LocationContig_440:8141..9810
Strand+
Gene length (bp)1669
Transcript length (bp)1560
Coding sequence length (bp)1560
Protein length (aa) 520

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 2.6E-04 239 266
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 3.3E-06 272 300
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 4.6E-07 319 347
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 1.5E-06 354 380
PF01239 PPTA Protein prenyltransferase alpha subunit repeat 1.7E-04 407 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y765|FNTA_CANAX Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Candida albicans GN=RAM2 PE=1 SV=1 194 510 5.0E-63
sp|O60052|FNTA_SCHPO Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwp1 PE=1 SV=1 194 438 5.0E-51
sp|Q54RT9|FNTA_DICDI Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Dictyostelium discoideum GN=fntA PE=3 SV=1 189 506 2.0E-47
sp|P93227|FNTA_SOLLC Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Solanum lycopersicum GN=FTA PE=1 SV=1 193 506 4.0E-47
sp|P29703|FNTA_YEAST Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAM2 PE=1 SV=1 192 511 3.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y765|FNTA_CANAX Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Candida albicans GN=RAM2 PE=1 SV=1 194 510 5.0E-63
sp|O60052|FNTA_SCHPO Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwp1 PE=1 SV=1 194 438 5.0E-51
sp|Q54RT9|FNTA_DICDI Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Dictyostelium discoideum GN=fntA PE=3 SV=1 189 506 2.0E-47
sp|P93227|FNTA_SOLLC Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Solanum lycopersicum GN=FTA PE=1 SV=1 193 506 4.0E-47
sp|P29703|FNTA_YEAST Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAM2 PE=1 SV=1 192 511 3.0E-46
sp|P29702|FNTA_BOVIN Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Bos taurus GN=FNTA PE=2 SV=2 193 438 1.0E-44
sp|P49354|FNTA_HUMAN Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens GN=FNTA PE=1 SV=1 194 438 1.0E-42
sp|Q61239|FNTA_MOUSE Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Mus musculus GN=Fnta PE=1 SV=1 194 438 4.0E-42
sp|O24304|FNTA_PEA Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Pisum sativum GN=FTA PE=1 SV=1 189 510 6.0E-42
sp|Q04631|FNTA_RAT Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Rattus norvegicus GN=Fnta PE=1 SV=1 194 438 2.0E-41
sp|Q9LX33|FNTA_ARATH Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Arabidopsis thaliana GN=FTA PE=1 SV=2 189 510 2.0E-38
sp|A5A779|PGTA_PIG Geranylgeranyl transferase type-2 subunit alpha OS=Sus scrofa GN=RABGGTA PE=2 SV=1 240 437 5.0E-16
sp|Q5NVK5|PGTA_PONAB Geranylgeranyl transferase type-2 subunit alpha OS=Pongo abelii GN=RABGGTA PE=2 SV=1 240 472 3.0E-15
sp|Q92696|PGTA_HUMAN Geranylgeranyl transferase type-2 subunit alpha OS=Homo sapiens GN=RABGGTA PE=1 SV=2 240 437 3.0E-15
sp|Q9JHK4|PGTA_MOUSE Geranylgeranyl transferase type-2 subunit alpha OS=Mus musculus GN=Rabggta PE=1 SV=1 240 437 4.0E-15
sp|Q5EA80|PGTA_BOVIN Geranylgeranyl transferase type-2 subunit alpha OS=Bos taurus GN=RABGGTA PE=2 SV=1 240 437 8.0E-15
sp|Q08602|PGTA_RAT Geranylgeranyl transferase type-2 subunit alpha OS=Rattus norvegicus GN=Rabggta PE=1 SV=1 240 437 1.0E-14
sp|Q00618|PGTA_YEAST Geranylgeranyl transferase type-2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET4 PE=1 SV=3 236 444 1.0E-09
sp|Q55DQ4|PGTA_DICDI Geranylgeranyl transferase type-2 subunit alpha OS=Dictyostelium discoideum GN=rabggta PE=3 SV=2 240 429 5.0E-08
sp|O93829|PGTA_CANAX Geranylgeranyl transferase type-2 subunit alpha OS=Candida albicans GN=BET4 PE=3 SV=1 231 501 2.0E-07
sp|O94412|PGTA_SCHPO Geranylgeranyl transferase type-2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet4 PE=3 SV=1 214 434 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008318 protein prenyltransferase activity Yes
GO:0018342 protein prenylation Yes
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0097354 prenylation No
GO:0008152 metabolic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0043412 macromolecule modification No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0004659 prenyltransferase activity No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5016
MPPKAKVGHKATNPAPIAAESQAPREPETIDERSHLRFLQSNTLEQRRREAGLSGLTPAEYKNYTYTRLIGPVAQ
RQVSLSAKSEREFWKHVVREGLPVQRLRDDYTWGTDRNGQNVGSYTLQDFDERCDQQTRLAALDILHRCFLSSRE
RTIAQGGDVEAQVIEEEKARRKEMASLRHDLYGEYSESLAAEPEWDDVMPVPLEEPDDALARIAYPEEYEEALSY
LRACMAAQECSPRCLRLTEHVISMNPAHYTVWLYRFKIISTLNLSVAEEIEWLNQVALDNLKNYQIWHHRQLLLD
FYYPTIAADADAVKQLAKSETDFIATILEEDTKNYHVWSYRQYLVDKLGLWTASELEWTETMIDNDVRNNSAWSH
RFFLVFSDPSVASEPKPQPMSHDDKIPQAIINRELAFAQAKIALAPQNQSGWNYLRGVLTKGGRTFDQEKAFAAQ
YVIKLGQEEEVVHSSHALDLLAEAYAAQGEKEEAKLCLQRLCDKWDPVREGYWKFRMEELDRDSTPTID*
Coding >OphauG2|5016
ATGCCGCCCAAGGCCAAGGTAGGGCACAAGGCCACAAACCCCGCGCCCATAGCGGCCGAATCTCAAGCCCCGCGT
GAGCCAGAAACGATTGATGAGCGCTCCCATCTCCGGTTTCTGCAGTCCAATACCCTCGAGCAGCGGCGCCGTGAA
GCTGGTCTGAGCGGCCTCACTCCAGCAGAATACAAAAACTACACCTACACACGCCTCATTGGCCCCGTGGCACAG
CGCCAAGTGTCGCTTTCAGCCAAATCAGAGCGCGAGTTTTGGAAGCACGTTGTACGCGAGGGACTGCCCGTGCAA
CGTTTGCGCGACGACTATACCTGGGGCACCGATCGCAACGGACAAAACGTTGGCTCCTACACCCTGCAAGATTTT
GACGAGCGCTGCGATCAGCAGACTCGGCTGGCTGCTCTCGACATCTTGCACCGCTGCTTCCTTTCATCCAGAGAG
CGGACCATAGCACAGGGAGGAGACGTAGAAGCACAAGTCATTGAGGAAGAGAAGGCGCGAAGAAAAGAAATGGCT
TCCCTAAGGCACGACTTGTATGGCGAGTATTCCGAATCGCTGGCTGCTGAGCCCGAATGGGACGATGTGATGCCC
GTCCCACTCGAGGAGCCCGACGACGCTCTCGCCCGCATAGCGTATCCTGAAGAATACGAAGAGGCTTTGTCGTAC
CTGCGTGCCTGCATGGCGGCCCAAGAGTGCTCTCCGCGCTGTCTTCGTCTGACAGAGCATGTCATTTCCATGAAC
CCTGCTCACTACACGGTTTGGCTGTATCGGTTCAAGATTATTTCGACGCTTAACCTGTCTGTTGCTGAGGAAATA
GAATGGCTCAACCAGGTTGCTCTTGATAATCTAAAAAACTACCAGATCTGGCACCATCGACAGCTGCTGCTCGAC
TTCTACTACCCTACCATTGCCGCGGATGCCGACGCTGTTAAGCAGCTGGCCAAGTCGGAGACTGATTTCATTGCG
ACCATTCTCGAAGAAGACACCAAAAACTACCACGTCTGGTCCTATCGACAATACCTAGTGGACAAATTGGGCCTG
TGGACCGCCAGCGAGCTCGAGTGGACCGAGACCATGATCGACAATGATGTGCGTAACAATTCAGCCTGGTCACAT
CGCTTCTTTCTTGTCTTTTCAGACCCTTCGGTAGCCTCAGAGCCCAAACCTCAGCCCATGAGTCACGACGACAAG
ATTCCCCAAGCCATCATCAATAGAGAGCTCGCCTTTGCCCAGGCCAAGATTGCTCTCGCTCCACAGAACCAATCC
GGATGGAACTATCTCCGCGGCGTCTTGACAAAGGGAGGACGTACATTTGACCAAGAAAAGGCATTTGCAGCACAA
TACGTGATCAAACTAGGCCAAGAGGAAGAAGTCGTGCATAGTTCACATGCTCTGGACCTGCTTGCTGAGGCATAT
GCCGCGCAAGGGGAAAAGGAAGAGGCCAAACTGTGCCTGCAAAGACTGTGCGACAAGTGGGACCCGGTGCGAGAG
GGCTACTGGAAATTTCGCATGGAAGAGCTGGATAGGGACAGCACGCCAACCATTGATTAG
Transcript >OphauG2|5016
ATGCCGCCCAAGGCCAAGGTAGGGCACAAGGCCACAAACCCCGCGCCCATAGCGGCCGAATCTCAAGCCCCGCGT
GAGCCAGAAACGATTGATGAGCGCTCCCATCTCCGGTTTCTGCAGTCCAATACCCTCGAGCAGCGGCGCCGTGAA
GCTGGTCTGAGCGGCCTCACTCCAGCAGAATACAAAAACTACACCTACACACGCCTCATTGGCCCCGTGGCACAG
CGCCAAGTGTCGCTTTCAGCCAAATCAGAGCGCGAGTTTTGGAAGCACGTTGTACGCGAGGGACTGCCCGTGCAA
CGTTTGCGCGACGACTATACCTGGGGCACCGATCGCAACGGACAAAACGTTGGCTCCTACACCCTGCAAGATTTT
GACGAGCGCTGCGATCAGCAGACTCGGCTGGCTGCTCTCGACATCTTGCACCGCTGCTTCCTTTCATCCAGAGAG
CGGACCATAGCACAGGGAGGAGACGTAGAAGCACAAGTCATTGAGGAAGAGAAGGCGCGAAGAAAAGAAATGGCT
TCCCTAAGGCACGACTTGTATGGCGAGTATTCCGAATCGCTGGCTGCTGAGCCCGAATGGGACGATGTGATGCCC
GTCCCACTCGAGGAGCCCGACGACGCTCTCGCCCGCATAGCGTATCCTGAAGAATACGAAGAGGCTTTGTCGTAC
CTGCGTGCCTGCATGGCGGCCCAAGAGTGCTCTCCGCGCTGTCTTCGTCTGACAGAGCATGTCATTTCCATGAAC
CCTGCTCACTACACGGTTTGGCTGTATCGGTTCAAGATTATTTCGACGCTTAACCTGTCTGTTGCTGAGGAAATA
GAATGGCTCAACCAGGTTGCTCTTGATAATCTAAAAAACTACCAGATCTGGCACCATCGACAGCTGCTGCTCGAC
TTCTACTACCCTACCATTGCCGCGGATGCCGACGCTGTTAAGCAGCTGGCCAAGTCGGAGACTGATTTCATTGCG
ACCATTCTCGAAGAAGACACCAAAAACTACCACGTCTGGTCCTATCGACAATACCTAGTGGACAAATTGGGCCTG
TGGACCGCCAGCGAGCTCGAGTGGACCGAGACCATGATCGACAATGATGTGCGTAACAATTCAGCCTGGTCACAT
CGCTTCTTTCTTGTCTTTTCAGACCCTTCGGTAGCCTCAGAGCCCAAACCTCAGCCCATGAGTCACGACGACAAG
ATTCCCCAAGCCATCATCAATAGAGAGCTCGCCTTTGCCCAGGCCAAGATTGCTCTCGCTCCACAGAACCAATCC
GGATGGAACTATCTCCGCGGCGTCTTGACAAAGGGAGGACGTACATTTGACCAAGAAAAGGCATTTGCAGCACAA
TACGTGATCAAACTAGGCCAAGAGGAAGAAGTCGTGCATAGTTCACATGCTCTGGACCTGCTTGCTGAGGCATAT
GCCGCGCAAGGGGAAAAGGAAGAGGCCAAACTGTGCCTGCAAAGACTGTGCGACAAGTGGGACCCGGTGCGAGAG
GGCTACTGGAAATTTCGCATGGAAGAGCTGGATAGGGACAGCACGCCAACCATTGATTAG
Gene >OphauG2|5016
ATGCCGCCCAAGGCCAAGGTAGGGCACAAGGCCACAAACCCCGCGCCCATAGGTTTGCCTTTGGCTCGTGAAGCA
GAAAAAAAGGCCATACATTAACACTTGTCGTCAGCGGCCGAATCTCAAGCCCCGCGTGAGCCAGAAACGATTGAT
GAGCGCTCCCATCTCCGGTTTCTGCAGTCCAATACCCTCGAGCAGCGGCGCCGTGAAGCTGGTCTGAGCGGCCTC
ACTCCAGCAGAATACAAAAACTACACCTACACACGCCTCATTGGCCCCGTGGCACAGCGCCAAGTGTCGCTTTCA
GCCAAATCAGAGCGCGAGTTTTGGAAGCACGTTGTACGCGAGGGACTGCCCGTGCAACGTTTGCGCGACGACTAT
ACCTGGGGCACCGATCGCAACGGACAAAACGTTGGCTCCTACACCCTGCAAGATTTTGACGAGCGCTGCGATCAG
CAGACTCGGCTGGCTGCTCTCGACATCTTGCACCGCTGCTTCCTTTCATCCAGAGAGCGGACCATAGCACAGGGA
GGAGACGTAGAAGCACAAGTCATTGAGGAAGAGAAGGCGCGAAGAAAAGAAATGGCTTCCCTAAGGCACGACTTG
TATGGCGAGTATTCCGAATCGCTGGCTGCTGAGCCCGAATGGGACGATGTGATGCCCGTCCCACTCGAGGAGCCC
GACGACGCTCTCGCCCGCATAGCGTATCCTGAAGAATACGAAGAGGGTGAGTAACGTGCTGCTCCATGCAAATGT
CTGATGCTGACACCCGTCGCCAGCTTTGTCGTACCTGCGTGCCTGCATGGCGGCCCAAGAGTGCTCTCCGCGCTG
TCTTCGTCTGACAGAGCATGTCATTTCCATGAACCCTGCTCACTACACGGTTTGGCTGTATCGGTTCAAGATTAT
TTCGACGCTTAACCTGTCTGTTGCTGAGGAAATAGAATGGCTCAACCAGGTTGCTCTTGATAATCTAAAAAACTA
CCAGATCTGGCACCATCGACAGCTGCTGCTCGACTTCTACTACCCTACCATTGCCGCGGATGCCGACGCTGTTAA
GCAGCTGGCCAAGTCGGAGACTGATTTCATTGCGACCATTCTCGAAGAAGACACCAAAAACTACCACGTCTGGTC
CTATCGACAATACCTAGTGGACAAATTGGGCCTGTGGACCGCCAGCGAGCTCGAGTGGACCGAGACCATGATCGA
CAATGATGTGCGTAACAATTCAGCCTGGTCACATCGCTTCTTTCTTGTCTTTTCAGACCCTTCGGTAGCCTCAGA
GCCCAAACCTCAGCCCATGAGTCACGACGACAAGATTCCCCAAGCCATCATCAATAGAGAGCTCGCCTTTGCCCA
GGCCAAGATTGCTCTCGCTCCACAGAACCAATCCGGATGGAACTATCTCCGCGGCGTCTTGACAAAGGGAGGACG
TACATTTGACCAAGAAAAGGCATTTGCAGCACAATACGTGATCAAACTAGGCCAAGAGGAAGAAGTCGTGCATAG
TTCACATGCTCTGGACCTGCTTGCTGAGGCATATGCCGCGCAAGGGGAAAAGGAAGAGGCCAAACTGTGCCTGCA
AAGACTGTGCGACAAGTGGGACCCGGTGCGAGAGGGCTACTGGAAATTTCGCATGGAAGAGCTGGATAGGGACAG
CACGCCAACCATTGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail