Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5013
Gene name
LocationContig_440:3249..4072
Strand-
Gene length (bp)823
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain 2.6E-17 14 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3UG98|NAT9_MOUSE N-acetyltransferase 9 OS=Mus musculus GN=Nat9 PE=1 SV=2 1 230 3.0E-31
sp|Q9BTE0|NAT9_HUMAN N-acetyltransferase 9 OS=Homo sapiens GN=NAT9 PE=1 SV=1 1 227 5.0E-31
sp|Q9BKR0|NAT9_CAEEL N-acetyltransferase 9-like protein OS=Caenorhabditis elegans GN=Y67D2.5 PE=3 SV=2 1 227 5.0E-29
sp|A7SLC8|NAT9_NEMVE N-acetyltransferase 9-like protein OS=Nematostella vectensis GN=nat9 PE=3 SV=1 1 227 2.0E-28
sp|Q9USR6|NAT9_SCHPO N-acetyltransferase 9-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC577.03c PE=3 SV=1 1 227 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3UG98|NAT9_MOUSE N-acetyltransferase 9 OS=Mus musculus GN=Nat9 PE=1 SV=2 1 230 3.0E-31
sp|Q9BTE0|NAT9_HUMAN N-acetyltransferase 9 OS=Homo sapiens GN=NAT9 PE=1 SV=1 1 227 5.0E-31
sp|Q9BKR0|NAT9_CAEEL N-acetyltransferase 9-like protein OS=Caenorhabditis elegans GN=Y67D2.5 PE=3 SV=2 1 227 5.0E-29
sp|A7SLC8|NAT9_NEMVE N-acetyltransferase 9-like protein OS=Nematostella vectensis GN=nat9 PE=3 SV=1 1 227 2.0E-28
sp|Q9USR6|NAT9_SCHPO N-acetyltransferase 9-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC577.03c PE=3 SV=1 1 227 1.0E-27
sp|Q9V9V9|NAT9_DROME N-acetyltransferase 9-like protein OS=Drosophila melanogaster GN=CG11539 PE=2 SV=1 1 227 1.0E-27
sp|Q61FA3|NAT9_CAEBR N-acetyltransferase 9-like protein OS=Caenorhabditis briggsae GN=CBG11716 PE=3 SV=1 1 227 2.0E-25
sp|Q86II5|NAT9_DICDI N-acetyltransferase 9-like protein OS=Dictyostelium discoideum GN=nat9 PE=3 SV=1 1 227 1.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016746 acyltransferase activity No
GO:0003824 catalytic activity No
GO:0016407 acetyltransferase activity No
GO:0016410 N-acyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5673
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5013 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7963
Ophiocordyceps camponoti-floridani Ophcf2|03525
Ophiocordyceps kimflemingae Ophio5|8473
Ophiocordyceps subramaniannii Hirsu2|8277

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5013
MRLNQDTAVATQQVLLVPYETRHVGKYHDWMQDARVREATASELLSLEEEHENQVAWRLAGDKLTFIVCEAIGSD
SEGSEDQGRGKEKDGETRGEKREQSVQAGECDAEERMRGDVNLFLSPDQDSGGVVGEVDVMIASTADRGRGLGMG
AVRALLCYVVGNVDGLVTEYQSSTGQCGPGSGRDGSDAGLRGLRVKIGQRNHASRALFAKLGFEERGKVDYFGEV
TMVMAWGDVVAKAGVEGYRELRYSRRAR*
Coding >OphauG2|5013
ATGAGACTCAATCAAGACACTGCGGTTGCAACGCAACAGGTGCTGCTGGTGCCGTACGAGACTCGGCATGTGGGC
AAATACCACGACTGGATGCAGGACGCAAGAGTGCGAGAAGCCACGGCATCGGAGCTGCTCAGCCTGGAAGAAGAG
CACGAGAATCAAGTAGCATGGCGATTAGCAGGGGATAAGTTGACGTTTATTGTGTGCGAGGCTATTGGAAGCGAC
TCGGAGGGCAGTGAGGACCAAGGACGAGGCAAAGAGAAAGATGGAGAGACAAGAGGCGAGAAAAGGGAGCAGTCA
GTGCAGGCGGGCGAGTGCGACGCAGAAGAGCGAATGCGAGGCGACGTCAACCTCTTTCTGTCGCCGGACCAGGAC
AGCGGCGGAGTGGTGGGCGAGGTGGACGTGATGATTGCGTCGACGGCGGATCGAGGCCGCGGGCTGGGCATGGGA
GCGGTTCGCGCGCTGCTCTGCTATGTCGTGGGCAACGTGGACGGCCTTGTTACGGAGTACCAGAGCAGCACGGGG
CAATGCGGACCGGGCAGTGGGCGAGACGGGTCGGACGCTGGGCTGCGAGGCCTCCGGGTAAAGATTGGGCAGAGG
AACCATGCTAGCAGAGCGCTGTTTGCAAAGCTGGGCTTTGAGGAGCGTGGCAAGGTGGATTACTTTGGAGAGGTG
ACCATGGTGATGGCTTGGGGGGACGTGGTGGCCAAGGCGGGGGTGGAGGGGTACAGAGAGCTGAGGTACTCGAGA
CGGGCACGATGA
Transcript >OphauG2|5013
ATGAGACTCAATCAAGACACTGCGGTTGCAACGCAACAGGTGCTGCTGGTGCCGTACGAGACTCGGCATGTGGGC
AAATACCACGACTGGATGCAGGACGCAAGAGTGCGAGAAGCCACGGCATCGGAGCTGCTCAGCCTGGAAGAAGAG
CACGAGAATCAAGTAGCATGGCGATTAGCAGGGGATAAGTTGACGTTTATTGTGTGCGAGGCTATTGGAAGCGAC
TCGGAGGGCAGTGAGGACCAAGGACGAGGCAAAGAGAAAGATGGAGAGACAAGAGGCGAGAAAAGGGAGCAGTCA
GTGCAGGCGGGCGAGTGCGACGCAGAAGAGCGAATGCGAGGCGACGTCAACCTCTTTCTGTCGCCGGACCAGGAC
AGCGGCGGAGTGGTGGGCGAGGTGGACGTGATGATTGCGTCGACGGCGGATCGAGGCCGCGGGCTGGGCATGGGA
GCGGTTCGCGCGCTGCTCTGCTATGTCGTGGGCAACGTGGACGGCCTTGTTACGGAGTACCAGAGCAGCACGGGG
CAATGCGGACCGGGCAGTGGGCGAGACGGGTCGGACGCTGGGCTGCGAGGCCTCCGGGTAAAGATTGGGCAGAGG
AACCATGCTAGCAGAGCGCTGTTTGCAAAGCTGGGCTTTGAGGAGCGTGGCAAGGTGGATTACTTTGGAGAGGTG
ACCATGGTGATGGCTTGGGGGGACGTGGTGGCCAAGGCGGGGGTGGAGGGGTACAGAGAGCTGAGGTACTCGAGA
CGGGCACGATGA
Gene >OphauG2|5013
ATGAGACTCAATCAAGACACTGGCAAGTAAAGCAAGCGTCGGAGCAAGAAAATGCTGGGCAGTGGATAACAAGCA
AGACGTAGCGGTTGCAACGCAACAGGTGCTGCTGGTGCCGTACGAGACTCGGCATGTGGGCAAATACCACGACTG
GATGCAGGACGCAAGAGTGCGAGAAGCCACGGCATCGGAGCTGCTCAGCCTGGAAGAAGAGCACGAGAATCAAGT
AGCATGGCGATTAGCAGGGGATAAGTTGACGTTTATTGTGTGCGAGGCTATTGGAAGCGACTCGGAGGGCAGTGA
GGACCAAGGACGAGGCAAAGAGAAAGATGGAGAGACAAGAGGCGAGAAAAGGGAGCAGTCAGTGCAGGCGGGCGA
GTGCGACGCAGAAGAGCGAATGCGAGGCGACGTCAACCTCTTTCTGTCGCCGGACCAGGACAGCGGCGGAGTGGT
GGGCGAGGTGGACGTGATGATTGCGTCGACGGCGGATCGAGGCCGCGGGCTGGGCATGGGAGCGGTTCGCGCGCT
GCTCTGCTATGTCGTGGGCAACGTGGACGGCCTTGTTACGGAGTACCAGAGCAGCACGGGGCAATGCGGACCGGG
CAGTGGGCGAGACGGGTCGGACGCTGGGCTGCGAGGCCTCCGGGTAAAGATTGGGCAGAGGAACCATGCTAGCAG
AGCGCTGTTTGCAAAGCTGGGCTTTGAGGAGCGTGGCAAGGTGGATTACTTTGGAGAGGTGACCATGGTGATGGC
TTGGGGGGACGTGGTGGCCAAGGCGGGGGTGGAGGGGTACAGAGAGCTGAGGTACTCGAGACGGGCACGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail