Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|501
Gene name
LocationContig_1113:3375..5373
Strand+
Gene length (bp)1998
Transcript length (bp)1686
Coding sequence length (bp)1686
Protein length (aa) 562

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 2.3E-24 334 542

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 196 546 5.0E-29
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 196 546 4.0E-28
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 194 549 1.0E-24
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 222 549 1.0E-23
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 222 549 5.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 196 546 5.0E-29
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 196 546 4.0E-28
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 194 549 1.0E-24
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 222 549 1.0E-23
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 222 549 5.0E-23
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 221 542 1.0E-18
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 221 542 1.0E-18
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 243 545 6.0E-16
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 221 545 2.0E-12
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 221 542 2.0E-12
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 245 542 8.0E-12
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 331 550 1.0E-11
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 334 538 1.0E-11
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 334 538 5.0E-11
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 334 542 1.0E-10
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 334 542 2.0E-10
sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 334 542 3.0E-10
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 394 543 4.0E-10
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 334 538 6.0E-10
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 334 542 6.0E-10
sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 334 538 7.0E-10
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 392 542 1.0E-09
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 334 538 1.0E-09
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 259 538 1.0E-09
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 334 550 3.0E-09
sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 334 538 3.0E-09
sp|Q43239|COMT1_ZINVI Caffeic acid 3-O-methyltransferase OS=Zinnia violacea PE=2 SV=1 334 542 4.0E-09
sp|P46484|COMT1_EUCGU Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1 334 542 5.0E-09
sp|Q9XGW0|COMT1_OCIBA Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1 334 542 6.0E-09
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 384 543 1.0E-08
sp|Q6T1F5|COMT1_AMMMJ Caffeic acid 3-O-methyltransferase OS=Ammi majus GN=COMT PE=1 SV=1 334 542 1.0E-08
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 334 550 1.0E-08
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 228 554 2.0E-08
sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 334 550 2.0E-08
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 190 545 3.0E-08
sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 334 550 3.0E-08
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 334 542 3.0E-08
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 245 542 5.0E-08
sp|O82054|COMT1_SACOF Caffeic acid 3-O-methyltransferase OS=Saccharum officinarum GN=COMT PE=2 SV=1 334 542 8.0E-08
sp|Q9XGV9|COMT2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1 334 538 9.0E-08
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 229 545 1.0E-07
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 334 542 1.0E-07
sp|Q54527|RDMB_STREF Aclacinomycin 10-hydroxylase RdmB OS=Streptomyces purpurascens GN=rdmB PE=1 SV=1 394 534 3.0E-07
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 208 547 4.0E-07
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 338 542 7.0E-07
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 228 542 8.0E-07
sp|Q06509|COMT1_MAIZE Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1 334 542 1.0E-06
sp|Q55216|DNRK_STRS5 Carminomycin 4-O-methyltransferase DauK OS=Streptomyces sp. (strain C5) GN=dauK PE=1 SV=1 251 542 3.0E-06
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 393 542 3.0E-06
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 395 540 4.0E-06
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 393 542 4.0E-06
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 393 538 5.0E-06
sp|Q6ZD89|OMT1_ORYSJ Flavone 3'-O-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=ROMT-9 PE=1 SV=1 449 542 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup781
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|501 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3062
Ophiocordyceps camponoti-floridani Ophcf2|00878
Ophiocordyceps camponoti-rufipedis Ophun1|5296
Ophiocordyceps kimflemingae Ophio5|1570
Ophiocordyceps subramaniannii Hirsu2|2972

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|501
MQDSSSLASGHTTPQQQGSIKSTLNAASPMSPVSSVSPPALGNKMPAPLLTAARPGPRSLSHYPPLGHIALAMAK
FKMPSWLYSTTNMPDAKKHHRRSFAGFSTPKAKHKPMSKQSDMTVVKSNVSSEPSQLSPPPPPSPPGAVSPMRHL
ATKIGLEADVLDEYITTNNLPEPGLDAKAPAEFPNLPFQMQTRRQELIVALTQLLALLRGPRESIRLGAWGALDV
AGLQLINNYGIAQLVPLDSPIALTELQAQSGMNPVTLARVLRFVMTNHIFHEPAPGFIAHTAASRVLAQDAALRD
WVGFNTEEVFPASAHVLDALKKDAEATSLTATGFNVAFGTFGTKSIFDTLGDDPQRAKRMVGTMSSMTCSQGYET
HYFVESVDLAKENELEGTLVDVGGSHGLVCVELAQRWDKMKFVVQDLDKTVKSTPQPICDDPAVAQRIQMQVHDF
FQEQPVKNADVYLFRWIIHNYSTPYAVKLLRNLIPALKPGARIIINEHCIRTAGGETPWDERLMRSMDMVMMALL
NAEEREEKEFRALFEQADARFTFKVKLLPVCLPRCL*
Coding >OphauG2|501
ATGCAAGACTCAAGTTCGCTTGCAAGTGGACACACGACACCGCAGCAGCAAGGTTCCATCAAGAGCACCCTCAAT
GCTGCCTCGCCCATGTCTCCCGTGTCTTCTGTCTCTCCTCCTGCACTGGGCAACAAGATGCCGGCGCCTCTGCTG
ACGGCTGCTCGCCCAGGTCCACGTAGCTTGTCGCACTATCCGCCCCTCGGCCACATAGCACTGGCCATGGCCAAG
TTCAAGATGCCTTCGTGGCTGTACTCAACAACAAACATGCCCGATGCCAAGAAGCATCATCGCCGCTCTTTTGCG
GGCTTTTCCACTCCCAAGGCCAAGCACAAGCCCATGTCCAAGCAAAGCGACATGACTGTCGTCAAGAGCAACGTC
TCGTCGGAACCTAGCCAGCTGTCGCCCCCTCCCCCTCCCTCTCCCCCGGGTGCTGTCTCTCCCATGCGCCATCTG
GCAACCAAGATTGGCCTCGAGGCAGACGTCTTGGATGAGTACATTACCACCAACAATCTTCCAGAGCCAGGACTA
GACGCCAAGGCCCCCGCCGAGTTTCCCAATTTGCCTTTCCAGATGCAGACCAGGAGACAGGAGCTGATTGTAGCC
CTTACACAGCTCCTTGCTCTGTTACGCGGCCCGCGCGAGAGCATAAGACTCGGAGCTTGGGGTGCTCTCGACGTG
GCCGGTCTGCAACTCATCAACAACTATGGCATAGCACAACTCGTTCCCTTGGACTCTCCCATTGCATTGACAGAG
CTTCAGGCCCAGTCTGGCATGAATCCCGTAACGCTGGCTCGCGTATTACGTTTTGTAATGACCAATCACATCTTC
CACGAACCTGCGCCTGGCTTCATTGCGCATACCGCTGCCTCGCGCGTTCTCGCTCAAGACGCTGCCTTGCGCGAC
TGGGTTGGCTTCAACACCGAAGAAGTATTTCCCGCCTCGGCTCATGTCCTCGACGCCCTCAAGAAAGATGCCGAG
GCCACGTCGCTGACCGCAACCGGCTTCAATGTTGCCTTTGGCACTTTTGGCACCAAGTCAATTTTTGACACTTTG
GGCGACGACCCGCAGCGAGCAAAGCGCATGGTGGGAACAATGTCGAGCATGACGTGCTCCCAGGGCTATGAAACC
CACTACTTCGTCGAGAGTGTTGACCTTGCCAAGGAGAATGAGCTCGAGGGAACTCTGGTTGACGTTGGGGGCAGC
CATGGCTTGGTCTGTGTCGAGCTGGCCCAGCGGTGGGACAAGATGAAATTTGTCGTTCAGGATCTCGACAAGACG
GTCAAGAGCACGCCACAGCCCATCTGCGACGACCCAGCCGTGGCTCAAAGGATACAAATGCAGGTGCACGATTTT
TTCCAGGAACAGCCTGTCAAGAATGCCGATGTCTACCTTTTCCGCTGGATCATCCACAATTACTCGACGCCGTAC
GCGGTCAAGCTGCTCAGAAACCTGATACCGGCGCTCAAGCCTGGGGCGCGAATCATCATCAACGAACACTGCATT
CGTACGGCAGGTGGCGAGACGCCATGGGACGAGAGATTGATGCGAAGCATGGACATGGTGATGATGGCGCTGCTC
AACGCTGAGGAGCGTGAGGAGAAGGAGTTTCGGGCCCTCTTTGAACAGGCTGATGCACGCTTCACTTTCAAGGTG
AAGTTGCTGCCCGTCTGCTTGCCTCGCTGTCTTTGA
Transcript >OphauG2|501
ATGCAAGACTCAAGTTCGCTTGCAAGTGGACACACGACACCGCAGCAGCAAGGTTCCATCAAGAGCACCCTCAAT
GCTGCCTCGCCCATGTCTCCCGTGTCTTCTGTCTCTCCTCCTGCACTGGGCAACAAGATGCCGGCGCCTCTGCTG
ACGGCTGCTCGCCCAGGTCCACGTAGCTTGTCGCACTATCCGCCCCTCGGCCACATAGCACTGGCCATGGCCAAG
TTCAAGATGCCTTCGTGGCTGTACTCAACAACAAACATGCCCGATGCCAAGAAGCATCATCGCCGCTCTTTTGCG
GGCTTTTCCACTCCCAAGGCCAAGCACAAGCCCATGTCCAAGCAAAGCGACATGACTGTCGTCAAGAGCAACGTC
TCGTCGGAACCTAGCCAGCTGTCGCCCCCTCCCCCTCCCTCTCCCCCGGGTGCTGTCTCTCCCATGCGCCATCTG
GCAACCAAGATTGGCCTCGAGGCAGACGTCTTGGATGAGTACATTACCACCAACAATCTTCCAGAGCCAGGACTA
GACGCCAAGGCCCCCGCCGAGTTTCCCAATTTGCCTTTCCAGATGCAGACCAGGAGACAGGAGCTGATTGTAGCC
CTTACACAGCTCCTTGCTCTGTTACGCGGCCCGCGCGAGAGCATAAGACTCGGAGCTTGGGGTGCTCTCGACGTG
GCCGGTCTGCAACTCATCAACAACTATGGCATAGCACAACTCGTTCCCTTGGACTCTCCCATTGCATTGACAGAG
CTTCAGGCCCAGTCTGGCATGAATCCCGTAACGCTGGCTCGCGTATTACGTTTTGTAATGACCAATCACATCTTC
CACGAACCTGCGCCTGGCTTCATTGCGCATACCGCTGCCTCGCGCGTTCTCGCTCAAGACGCTGCCTTGCGCGAC
TGGGTTGGCTTCAACACCGAAGAAGTATTTCCCGCCTCGGCTCATGTCCTCGACGCCCTCAAGAAAGATGCCGAG
GCCACGTCGCTGACCGCAACCGGCTTCAATGTTGCCTTTGGCACTTTTGGCACCAAGTCAATTTTTGACACTTTG
GGCGACGACCCGCAGCGAGCAAAGCGCATGGTGGGAACAATGTCGAGCATGACGTGCTCCCAGGGCTATGAAACC
CACTACTTCGTCGAGAGTGTTGACCTTGCCAAGGAGAATGAGCTCGAGGGAACTCTGGTTGACGTTGGGGGCAGC
CATGGCTTGGTCTGTGTCGAGCTGGCCCAGCGGTGGGACAAGATGAAATTTGTCGTTCAGGATCTCGACAAGACG
GTCAAGAGCACGCCACAGCCCATCTGCGACGACCCAGCCGTGGCTCAAAGGATACAAATGCAGGTGCACGATTTT
TTCCAGGAACAGCCTGTCAAGAATGCCGATGTCTACCTTTTCCGCTGGATCATCCACAATTACTCGACGCCGTAC
GCGGTCAAGCTGCTCAGAAACCTGATACCGGCGCTCAAGCCTGGGGCGCGAATCATCATCAACGAACACTGCATT
CGTACGGCAGGTGGCGAGACGCCATGGGACGAGAGATTGATGCGAAGCATGGACATGGTGATGATGGCGCTGCTC
AACGCTGAGGAGCGTGAGGAGAAGGAGTTTCGGGCCCTCTTTGAACAGGCTGATGCACGCTTCACTTTCAAGGTG
AAGTTGCTGCCCGTCTGCTTGCCTCGCTGTCTTTGA
Gene >OphauG2|501
ATGCAAGACTCAAGTTCGCTTGCAAGTGGACACACGACACCGCAGCAGCAAGGTTCCATCAAGAGCACCCTCAAT
GCTGCCTCGGTTCGCCCTGTCAGAAATGCTTGCCTCATGAAGAAACAATCAGCGTTGCCTCCGCGACTTGTATGT
CTATGCGTGGCACTGATAACTCTGACGCCAGCCCATGTCTCCCGTGTCTTCTGTCTCTCCTCCTGCACTGGGCAA
CAAGATGCCGGCGCCTCTGCTGACGGCTGCTCGCCCAGGTCCACGTAGCTTGTCGCACTATCCGCCCCTCGGCCA
CATAGCACTGGCCATGGCCAAGTTCAAGATGCCTTCGTGGCTGTACTCAACAACAAACATGCCCGATGCCAAGAA
GCATCATCGCCGCTCTTTTGCGGGCTTTTCCACTCCCAAGGCCAAGCACAAGCCCATGTCCAAGCAAAGCGACAT
GACTGTCGTCAAGAGCAACGTCTCGTCGGAACCTAGCCAGCTGTCGCCCCCTCCCCCTCCCTCTCCCCCGGGTGC
TGTCTCTCCCATGCGCCATCTGGCAACCAAGATTGGCCTCGAGGCAGACGTCTTGGATGAGTACATTACCACCAA
CAATCTTCCAGAGCCAGGACTAGACGCCAAGGCCCCCGCCGAGTTTCCCAATTTGCCTTTCCAGATGCAGACCAG
GAGACAGGAGCTGATTGTAGCCCTTACACAGCTCCTTGCTCTGTTACGCGGCCCGCGCGAGAGCATAAGACTCGG
AGCTTGGGGTGTAAGACTTTGTGTTTTGACGTTTTTTTTTTCCTCTTTTTTTTTCCCCCCCGTGGCCCTTTTCTC
GCTGACTCTTCTGCCAGGCTCTCGACGTGGCCGGTCTGCAACTCATCAACAACTATGGCATAGGTACCGCCTCTT
GGCTCTACAGCTGGCTTCATGCTGACCTAGACTCACTTAGCACAACTCGTTCCCTTGGACTCTCCCATTGCATTG
ACAGAGCTTCAGGCCCAGTCTGGCATGAATCCCGTAACGCTGGCTCGCGTATTACGTTTTGTAATGACCAATCAC
ATCTTCCACGAACCTGCGCCTGGCTTCATTGCGCATACCGCTGCCTCGCGCGTTCTCGCTCAAGACGCTGCCTTG
CGCGACTGGGTTGGCTTCAACACCGAAGAAGTATTTCCCGCCTCGGCTCATGTCCTCGACGCCCTCAAGAAAGAT
GCCGAGGCCACGTCGCTGACCGCAACCGGCTTCAATGTTGCCTTTGGCACTTTTGGCACCAAGTCAATTTTTGAC
ACTTTGGGCGACGACCCGCAGCGAGCAAAGCGCATGGTGGGAACAATGTCGAGCATGACGTGCTCCCAGGGCTAT
GAAACCCACTACTTCGTCGAGAGTGTTGACCTTGCCAAGGAGAATGAGCTCGAGGGAACTCTGGTTGACGTTGGG
GGCAGCCATGGCTTGGTCTGTGTCGAGCTGGCCCAGCGGTGGGACAAGATGAAATTTGTCGTTCAGGATCTCGAC
AAGACGGTCAAGAGCACGCCACAGCCCATCTGCGACGACCCAGCCGTGGCTCAAAGGATACAAATGCAGGTGCAC
GATTTTTTCCAGGAACAGCCTGTCAAGAATGCCGATGGTATGGCTTCACCCCCTTGTCTGTCTCGTGGCAGCACC
AAAGTCACCGACTGAGCTGACGAGCTTGCCTGGCTCCCAACAGTCTACCTTTTCCGCTGGATCATCCACAATTAC
TCGACGCCGTACGCGGTCAAGCTGCTCAGAAACCTGATACCGGCGCTCAAGCCTGGGGCGCGAATCATCATCAAC
GAACACTGCATTCGTACGGCAGGTGGCGAGACGCCATGGGACGAGAGATTGATGCGAAGCATGGACATGGTGATG
ATGGCGCTGCTCAACGCTGAGGAGCGTGAGGAGAAGGAGTTTCGGGCCCTCTTTGAACAGGCTGATGCACGCTTC
ACTTTCAAGGTGAAGTTGCTGCCCGTCTGCTTGCCTCGCTGTCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail