Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5002
Gene name
LocationContig_44:25348..28638
Strand+
Gene length (bp)3290
Transcript length (bp)3234
Coding sequence length (bp)3234
Protein length (aa) 1078

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07575 Nucleopor_Nup85 Nup85 Nucleoporin 7.1E-13 523 904

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0SDQ4|NUP85_CHATD Nucleoporin NUP85 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP85 PE=3 SV=1 178 1074 0.0E+00

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2910
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5002 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2332
Ophiocordyceps camponoti-floridani Ophcf2|05430
Ophiocordyceps camponoti-rufipedis Ophun1|2178
Ophiocordyceps kimflemingae Ophio5|1180
Ophiocordyceps subramaniannii Hirsu2|4860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5002
MAQRFVIESSPPSSPEPATPEKKKTQQDADFSFGNQSTSTTPAGPPPRSSMASFASSPSTKESSKSQFKSLASGP
AARVGSSNLFGSVDQSRSSYSRLTRGRGMQPSRLSNQLSFDDEPIDQRSEVQYEEDIAHLRSNLFRPSVAQSSNR
NDSDDDTELEVERFINDDLEVEAENQDDSESEEASQAESEDMDLFLNMRHDDRPYGKAPIGEESEDLLMFKTPSA
THRILEEAEDIFYRSTARLGVLTRSQGFQFATFARNIYAEQEPARVTESSELILQTENLVYRLYEEGIGVEDDAE
RLDSSLGKVSKLVQLWNDHVNCLPQPEGEDFASIGPSSRAEPFEKASFIANLVLRMHHTRIYSDPGNPKAPPLPE
VLLDWIQVNHNLDPNQIKDVSRHKPSPACHVTFWQTLRCALLRGKVSDVVQLLRDACWENVRVGSQGGEAYSGQA
LENIRRFVGAACDVLEQCPGTRKDWDIWNSGWTLFRVQARGALDKLTIFAEGEASSSIGRKSQSMSTMARKASSQ
IPWDVYENLQSIYGIVLGKQSAILDTAQDWVEATIGLFTWLDDDSSRQRHGLSQSLGFGSSSSFSQSTDYLDRLA
SVFHRVLASNLTPNVMHPVEVAIASAFEGNVEAVIGCLRTWSLPVAASVAEIAALGHWLPKPQPAKPLPTDTLSM
EDLELLGVMPPTVDEVEGIKDTTLIVYARELAGIEYLRADKYGWELAIQILGRMDSATRSEQVIGELLRDLLATL
TEDSSVMVDKMWRLLNELGMLVFASETALTYAEILAKSSHRYGDALWYFALARRVEKVRDILNLLMSYSLLRSAA
YPVEDDLDQGLKNLLYKRTETLEQRAKQDLDAAQLLGRMLSGYATLRKFYELRERVNGEEKCRAKAMGLRRKAAQ
ALVIVISSSADSIRGGIYDATREAVVSEDFLLALLGEATVFVNQSPIMVSLEEIGVLLRAIEDLETVGSTIYDVC
DEFFALVLGSGQGLKGSTPLDLMTRSTNSLGSSSYIMSGSSMLASRLQEAIGPGGKIERGWDWRKRLTAKTKGAE
VLRKMRLGLAKDLAGLWLDEADGVAIF*
Coding >OphauG2|5002
ATGGCTCAACGATTCGTGATCGAATCGAGTCCGCCATCGAGCCCAGAGCCTGCAACTCCGGAGAAGAAGAAGACG
CAACAAGATGCTGACTTTTCTTTCGGAAATCAATCTACATCAACGACGCCGGCAGGCCCTCCACCCAGATCATCC
ATGGCCTCTTTCGCATCTTCGCCGAGCACTAAAGAAAGCTCCAAGTCGCAATTCAAGTCGCTTGCATCTGGTCCC
GCGGCTCGGGTAGGCTCTTCAAATCTATTTGGTAGCGTCGATCAATCCAGATCTTCGTATAGCCGACTTACGAGG
GGACGAGGAATGCAACCCTCACGCCTCAGTAATCAACTCAGTTTCGATGACGAACCCATAGACCAGCGCTCCGAG
GTACAATACGAAGAGGACATTGCACATCTTCGATCAAACTTGTTCCGTCCTTCAGTTGCCCAGTCATCAAACAGA
AACGACAGCGACGATGACACCGAACTCGAGGTGGAAAGGTTTATCAATGATGATCTGGAAGTTGAAGCAGAAAAC
CAAGATGACTCCGAGTCGGAAGAAGCCAGCCAAGCCGAATCCGAAGACATGGACCTATTTCTCAACATGCGCCAC
GACGATCGGCCTTACGGCAAAGCTCCAATTGGAGAGGAATCAGAAGATCTTCTAATGTTCAAGACACCCTCAGCC
ACGCACAGGATTCTCGAGGAAGCGGAAGACATATTTTACAGGTCTACAGCTCGCTTAGGGGTCTTGACTCGGAGT
CAGGGCTTCCAATTTGCCACATTTGCCCGGAATATTTATGCTGAGCAAGAGCCGGCCAGAGTAACAGAATCGTCT
GAGCTGATTCTCCAAACTGAGAATCTGGTCTACCGTCTCTATGAAGAAGGAATAGGAGTTGAAGATGATGCAGAG
AGGCTAGATTCCTCCCTGGGCAAAGTTTCAAAGCTTGTTCAGTTGTGGAACGACCATGTTAACTGTCTTCCCCAA
CCAGAAGGTGAAGACTTTGCTTCTATTGGGCCTAGTTCTCGCGCGGAACCTTTCGAAAAGGCTTCATTCATCGCC
AATCTTGTACTACGCATGCATCACACTAGAATTTACAGCGACCCTGGAAACCCCAAGGCGCCACCTCTGCCAGAA
GTTTTACTTGACTGGATACAAGTCAACCACAATCTGGATCCAAATCAAATAAAGGACGTTTCCAGGCATAAACCT
AGCCCAGCTTGTCACGTCACGTTTTGGCAAACGCTGCGCTGCGCTCTCCTTCGCGGCAAGGTCTCGGATGTTGTT
CAACTACTCAGAGACGCGTGTTGGGAAAATGTTCGTGTCGGGTCCCAGGGTGGCGAGGCGTATTCAGGTCAGGCA
TTGGAGAACATTCGTCGGTTCGTGGGTGCAGCCTGTGACGTGCTGGAACAATGTCCCGGTACGAGAAAAGACTGG
GACATTTGGAACAGTGGCTGGACATTGTTCCGCGTCCAGGCAAGAGGAGCACTGGATAAATTGACCATCTTTGCC
GAGGGCGAGGCCAGCAGCTCGATTGGACGAAAATCGCAAAGCATGTCGACCATGGCAAGAAAGGCATCAAGCCAG
ATACCATGGGACGTATACGAAAACCTACAGAGCATATACGGCATTGTACTTGGCAAGCAAAGTGCGATTCTTGAC
ACGGCGCAGGACTGGGTCGAAGCAACAATTGGACTTTTTACTTGGCTGGATGATGACAGTTCACGACAGAGACAC
GGGCTTTCCCAATCTCTCGGCTTTGGATCATCGTCCAGCTTCTCTCAATCGACGGATTATCTGGACCGCTTGGCC
TCTGTATTCCACCGAGTGCTTGCATCTAACTTGACGCCCAATGTCATGCACCCTGTCGAAGTGGCGATTGCATCA
GCCTTTGAGGGCAACGTTGAAGCGGTAATTGGTTGCCTGCGGACATGGTCGCTGCCGGTAGCGGCATCTGTAGCA
GAAATTGCAGCTCTCGGTCACTGGTTGCCGAAACCCCAGCCAGCTAAACCGCTGCCTACGGATACGCTTTCAATG
GAGGATCTTGAATTGCTAGGCGTGATGCCACCAACGGTGGACGAAGTAGAGGGGATCAAAGACACAACTTTGATA
GTCTACGCAAGGGAACTCGCCGGAATCGAGTATCTCCGTGCGGACAAATATGGATGGGAGCTGGCTATTCAAATA
CTGGGCAGAATGGATTCAGCGACGAGATCTGAGCAGGTCATTGGTGAACTGCTTCGAGACTTGTTGGCCACACTG
ACAGAGGATTCGAGCGTAATGGTGGATAAGATGTGGCGACTACTCAATGAGCTTGGCATGCTTGTCTTTGCCAGT
GAGACGGCACTGACTTATGCCGAGATTCTGGCCAAGAGCTCTCACCGATACGGCGATGCTCTATGGTACTTTGCT
CTGGCGCGTCGGGTAGAAAAAGTACGGGACATTTTAAATCTGCTCATGTCATATTCCCTGCTGCGCTCAGCAGCT
TATCCAGTGGAAGATGATTTGGACCAAGGACTCAAAAACCTACTCTATAAGCGCACCGAGACACTGGAGCAGCGT
GCAAAGCAAGACCTCGACGCAGCACAGCTACTGGGACGAATGCTGAGTGGGTATGCAACGCTACGCAAGTTTTAC
GAGCTCAGGGAGCGTGTCAATGGCGAGGAAAAGTGTCGAGCCAAAGCCATGGGGCTGCGAAGGAAGGCTGCTCAG
GCACTGGTGATTGTGATTTCGAGCTCTGCCGACAGTATCCGTGGCGGCATCTACGACGCGACGCGCGAAGCAGTG
GTGAGCGAAGACTTTTTGCTTGCGCTCTTGGGAGAGGCGACGGTATTTGTCAACCAATCGCCCATCATGGTGTCA
CTGGAGGAGATTGGGGTGCTCCTGAGGGCGATTGAGGACCTCGAAACGGTAGGGTCGACAATCTACGACGTTTGC
GACGAGTTCTTTGCCTTGGTGCTTGGCAGTGGGCAAGGGCTCAAGGGCTCGACGCCTTTGGACCTGATGACGAGG
TCGACAAACTCTTTGGGGTCAAGCAGCTATATCATGAGCGGAAGCTCCATGCTGGCCAGCCGTCTGCAGGAGGCG
ATTGGGCCAGGAGGCAAGATTGAGCGCGGGTGGGACTGGAGAAAGAGACTGACTGCCAAGACCAAGGGAGCAGAA
GTACTGCGAAAAATGCGGCTGGGACTGGCCAAGGACCTGGCAGGCTTGTGGCTTGACGAGGCGGATGGAGTTGCC
ATTTTTTAG
Transcript >OphauG2|5002
ATGGCTCAACGATTCGTGATCGAATCGAGTCCGCCATCGAGCCCAGAGCCTGCAACTCCGGAGAAGAAGAAGACG
CAACAAGATGCTGACTTTTCTTTCGGAAATCAATCTACATCAACGACGCCGGCAGGCCCTCCACCCAGATCATCC
ATGGCCTCTTTCGCATCTTCGCCGAGCACTAAAGAAAGCTCCAAGTCGCAATTCAAGTCGCTTGCATCTGGTCCC
GCGGCTCGGGTAGGCTCTTCAAATCTATTTGGTAGCGTCGATCAATCCAGATCTTCGTATAGCCGACTTACGAGG
GGACGAGGAATGCAACCCTCACGCCTCAGTAATCAACTCAGTTTCGATGACGAACCCATAGACCAGCGCTCCGAG
GTACAATACGAAGAGGACATTGCACATCTTCGATCAAACTTGTTCCGTCCTTCAGTTGCCCAGTCATCAAACAGA
AACGACAGCGACGATGACACCGAACTCGAGGTGGAAAGGTTTATCAATGATGATCTGGAAGTTGAAGCAGAAAAC
CAAGATGACTCCGAGTCGGAAGAAGCCAGCCAAGCCGAATCCGAAGACATGGACCTATTTCTCAACATGCGCCAC
GACGATCGGCCTTACGGCAAAGCTCCAATTGGAGAGGAATCAGAAGATCTTCTAATGTTCAAGACACCCTCAGCC
ACGCACAGGATTCTCGAGGAAGCGGAAGACATATTTTACAGGTCTACAGCTCGCTTAGGGGTCTTGACTCGGAGT
CAGGGCTTCCAATTTGCCACATTTGCCCGGAATATTTATGCTGAGCAAGAGCCGGCCAGAGTAACAGAATCGTCT
GAGCTGATTCTCCAAACTGAGAATCTGGTCTACCGTCTCTATGAAGAAGGAATAGGAGTTGAAGATGATGCAGAG
AGGCTAGATTCCTCCCTGGGCAAAGTTTCAAAGCTTGTTCAGTTGTGGAACGACCATGTTAACTGTCTTCCCCAA
CCAGAAGGTGAAGACTTTGCTTCTATTGGGCCTAGTTCTCGCGCGGAACCTTTCGAAAAGGCTTCATTCATCGCC
AATCTTGTACTACGCATGCATCACACTAGAATTTACAGCGACCCTGGAAACCCCAAGGCGCCACCTCTGCCAGAA
GTTTTACTTGACTGGATACAAGTCAACCACAATCTGGATCCAAATCAAATAAAGGACGTTTCCAGGCATAAACCT
AGCCCAGCTTGTCACGTCACGTTTTGGCAAACGCTGCGCTGCGCTCTCCTTCGCGGCAAGGTCTCGGATGTTGTT
CAACTACTCAGAGACGCGTGTTGGGAAAATGTTCGTGTCGGGTCCCAGGGTGGCGAGGCGTATTCAGGTCAGGCA
TTGGAGAACATTCGTCGGTTCGTGGGTGCAGCCTGTGACGTGCTGGAACAATGTCCCGGTACGAGAAAAGACTGG
GACATTTGGAACAGTGGCTGGACATTGTTCCGCGTCCAGGCAAGAGGAGCACTGGATAAATTGACCATCTTTGCC
GAGGGCGAGGCCAGCAGCTCGATTGGACGAAAATCGCAAAGCATGTCGACCATGGCAAGAAAGGCATCAAGCCAG
ATACCATGGGACGTATACGAAAACCTACAGAGCATATACGGCATTGTACTTGGCAAGCAAAGTGCGATTCTTGAC
ACGGCGCAGGACTGGGTCGAAGCAACAATTGGACTTTTTACTTGGCTGGATGATGACAGTTCACGACAGAGACAC
GGGCTTTCCCAATCTCTCGGCTTTGGATCATCGTCCAGCTTCTCTCAATCGACGGATTATCTGGACCGCTTGGCC
TCTGTATTCCACCGAGTGCTTGCATCTAACTTGACGCCCAATGTCATGCACCCTGTCGAAGTGGCGATTGCATCA
GCCTTTGAGGGCAACGTTGAAGCGGTAATTGGTTGCCTGCGGACATGGTCGCTGCCGGTAGCGGCATCTGTAGCA
GAAATTGCAGCTCTCGGTCACTGGTTGCCGAAACCCCAGCCAGCTAAACCGCTGCCTACGGATACGCTTTCAATG
GAGGATCTTGAATTGCTAGGCGTGATGCCACCAACGGTGGACGAAGTAGAGGGGATCAAAGACACAACTTTGATA
GTCTACGCAAGGGAACTCGCCGGAATCGAGTATCTCCGTGCGGACAAATATGGATGGGAGCTGGCTATTCAAATA
CTGGGCAGAATGGATTCAGCGACGAGATCTGAGCAGGTCATTGGTGAACTGCTTCGAGACTTGTTGGCCACACTG
ACAGAGGATTCGAGCGTAATGGTGGATAAGATGTGGCGACTACTCAATGAGCTTGGCATGCTTGTCTTTGCCAGT
GAGACGGCACTGACTTATGCCGAGATTCTGGCCAAGAGCTCTCACCGATACGGCGATGCTCTATGGTACTTTGCT
CTGGCGCGTCGGGTAGAAAAAGTACGGGACATTTTAAATCTGCTCATGTCATATTCCCTGCTGCGCTCAGCAGCT
TATCCAGTGGAAGATGATTTGGACCAAGGACTCAAAAACCTACTCTATAAGCGCACCGAGACACTGGAGCAGCGT
GCAAAGCAAGACCTCGACGCAGCACAGCTACTGGGACGAATGCTGAGTGGGTATGCAACGCTACGCAAGTTTTAC
GAGCTCAGGGAGCGTGTCAATGGCGAGGAAAAGTGTCGAGCCAAAGCCATGGGGCTGCGAAGGAAGGCTGCTCAG
GCACTGGTGATTGTGATTTCGAGCTCTGCCGACAGTATCCGTGGCGGCATCTACGACGCGACGCGCGAAGCAGTG
GTGAGCGAAGACTTTTTGCTTGCGCTCTTGGGAGAGGCGACGGTATTTGTCAACCAATCGCCCATCATGGTGTCA
CTGGAGGAGATTGGGGTGCTCCTGAGGGCGATTGAGGACCTCGAAACGGTAGGGTCGACAATCTACGACGTTTGC
GACGAGTTCTTTGCCTTGGTGCTTGGCAGTGGGCAAGGGCTCAAGGGCTCGACGCCTTTGGACCTGATGACGAGG
TCGACAAACTCTTTGGGGTCAAGCAGCTATATCATGAGCGGAAGCTCCATGCTGGCCAGCCGTCTGCAGGAGGCG
ATTGGGCCAGGAGGCAAGATTGAGCGCGGGTGGGACTGGAGAAAGAGACTGACTGCCAAGACCAAGGGAGCAGAA
GTACTGCGAAAAATGCGGCTGGGACTGGCCAAGGACCTGGCAGGCTTGTGGCTTGACGAGGCGGATGGAGTTGCC
ATTTTTTAG
Gene >OphauG2|5002
ATGGCTCAACGATTCGTGATCGAATCGAGTCCGCCATCGAGCCCAGAGCCTGCAACTCCGGAGAAGAAGAAGACG
CAACAAGATGCTGACTTTTCTTTCGGAAATCAATCTACATCAACGACGCCGGCAGGCCCTCCACCCAGATCATCC
ATGGCCTCTTTCGCATCTTCGCCGAGCACTAAAGAAAGCTCCAAGTCGCAATTCAAGTCGCTTGCATCTGGTCCC
GCGGCTCGGGTAGGCTCTTCAAATCTATTTGGTAGCGTCGATCAATCCAGATCTTCGTATAGCCGACTTACGAGG
GGACGAGGAATGCAACCCTCACGCCTCAGTAATCAACTCAGTTTCGATGACGAACCCATAGACCAGCGCTCCGAG
GTACAATACGAAGAGGACATTGCACATCTTCGATCAAACTTGTTCCGTCCTTCAGTTGCCCAGTCATCAAACAGA
AACGACAGCGACGATGACACCGAACTCGAGGTGGAAAGGTTTATCAATGATGATCTGGAAGTTGAAGCAGAAAAC
CAAGATGACTCCGAGTCGGAAGAAGCCAGCCAAGCCGAATCCGAAGACATGGACCTATTTCTCAACATGCGCCAC
GACGATCGGCCTTACGGCAAAGCTCCAATTGGAGAGGAATCAGAAGATCTTCTAATGTTCAAGACACCCTCAGCC
ACGCACAGGATTCTCGAGGAAGCGGAAGACATATTTTACAGGTCTACAGCTCGCTTAGGGGTCTTGACTCGGAGT
CAGGGCTTCCAATTTGCCACATTTGCCCGGAATATTTATGCTGAGCAAGAGCCGGCCAGAGTAACAGAATCGTCT
GAGCTGATTCTCCAAACTGAGAATCTGGTCTACCGTCTCTATGAAGAAGGAATAGGAGTTGAAGATGATGCAGAG
AGGCTAGATTCCTCCCTGGGCAAAGTTTCAAAGCTTGTTCAGTTGTGGAACGACCATGTTAACTGTCTTCCCCAA
CCAGAAGGTGAAGACTTTGCTTCTATTGGGCCTAGTTCTCGCGCGGAACCTTTCGAAAAGGCTTCATTCATCGCC
AATCTTGTACTACGCATGCATCACACTAGAATTTACAGCGACCCTGGAAACCCCAAGGCGCCACCTCTGCCAGAA
GTTTTACTTGACTGGATACAAGTCAACCACAATCTGGATCCAAATCAAATAAAGGACGTTTCCAGGCATAAACCT
AGCCCAGCTTGTCACGTCACGTTTTGGCAAACGCTGCGCTGCGCTCTCCTTCGCGGCAAGGTCTCGGATGTTGTT
CAACTACTCAGAGACGCGTGTTGGGAAAATGTTCGTGTCGGGTCCCAGGGTGGCGAGGCGTATTCAGGTCAGGCA
TTGGAGAACATTCGTCGGTTCGTGGGTGCAGCCTGTGACGTGCTGGAACAATGTCCCGGTACGAGAAAAGACTGG
GACATTTGGAACAGTGGCTGGACATTGTTCCGCGTCCAGGCAAGAGGAGCACTGGATAAATTGACCATCTTTGCC
GAGGGCGAGGCCAGCAGCTCGATTGGACGAAAATCGCAAAGCATGTCGACCATGGCAAGAAAGGCATCAAGCCAG
ATACCATGGGACGTATACGAAAACCTACAGAGCATATACGGCATTGTACTTGGCAAGCAAAGTGCGATTCTTGAC
ACGGCGCAGGACTGGGTCGAAGCAACAATTGGACTTTTTACTTGGCTGGATGATGACAGTTCACGACAGAGACAC
GGGCTTTCCCAATCTCTCGGCTTTGGATCATCGTCCAGCTTCTCTCAATCGACGGATTATCTGGACCGCTTGGCC
TCTGTATTCCACCGAGTGCTTGCATCTAACTTGACGCCCAATGTCATGCACCCTGTCGAAGTGGCGATTGCATCA
GCCTTTGAGGGCAACGTTGAAGCGGTAATTGGTTGCCTGCGGACATGGTCGCTGCCGGTAGCGGCATCTGTAGCA
GAAATTGCAGCTCTCGGTCACTGGTTGCCGAAACCCCAGCCAGCTAAACCGCTGCCTACGGATACGCTTTCAATG
GAGGATCTTGAATTGCTAGGCGTGATGCCACCAACGGTGGACGAAGTAGAGGGGATCAAAGACACAACTTTGATA
GTCTACGCAAGGGAACTCGCCGGAATCGAGTATCTCCGTGCGGACAAATATGGATGGGAGCTGGCTATTCAAATA
CTGGGCAGAATGGATTCAGCGACGAGATCTGAGCAGGTCATTGGTGAACTGCTTCGAGACTTGTTGGCCACACTG
ACAGAGGATTCGAGCGTAATGGTGGATAAGATGTGGCGACTACTCAATGAGCTTGGCATGCTTGTCTTTGCCAGT
GAGACGGCACTGGTAAGTGTAAAACATGAGGCGCGACTGGCAAGGACCAAGGCTCACCAATTCCTCAGACTTATG
CCGAGATTCTGGCCAAGAGCTCTCACCGATACGGCGATGCTCTATGGTACTTTGCTCTGGCGCGTCGGGTAGAAA
AAGTACGGGACATTTTAAATCTGCTCATGTCATATTCCCTGCTGCGCTCAGCAGCTTATCCAGTGGAAGATGATT
TGGACCAAGGACTCAAAAACCTACTCTATAAGCGCACCGAGACACTGGAGCAGCGTGCAAAGCAAGACCTCGACG
CAGCACAGCTACTGGGACGAATGCTGAGTGGGTATGCAACGCTACGCAAGTTTTACGAGCTCAGGGAGCGTGTCA
ATGGCGAGGAAAAGTGTCGAGCCAAAGCCATGGGGCTGCGAAGGAAGGCTGCTCAGGCACTGGTGATTGTGATTT
CGAGCTCTGCCGACAGTATCCGTGGCGGCATCTACGACGCGACGCGCGAAGCAGTGGTGAGCGAAGACTTTTTGC
TTGCGCTCTTGGGAGAGGCGACGGTATTTGTCAACCAATCGCCCATCATGGTGTCACTGGAGGAGATTGGGGTGC
TCCTGAGGGCGATTGAGGACCTCGAAACGGTAGGGTCGACAATCTACGACGTTTGCGACGAGTTCTTTGCCTTGG
TGCTTGGCAGTGGGCAAGGGCTCAAGGGCTCGACGCCTTTGGACCTGATGACGAGGTCGACAAACTCTTTGGGGT
CAAGCAGCTATATCATGAGCGGAAGCTCCATGCTGGCCAGCCGTCTGCAGGAGGCGATTGGGCCAGGAGGCAAGA
TTGAGCGCGGGTGGGACTGGAGAAAGAGACTGACTGCCAAGACCAAGGGAGCAGAAGTACTGCGAAAAATGCGGC
TGGGACTGGCCAAGGACCTGGCAGGCTTGTGGCTTGACGAGGCGGATGGAGTTGCCATTTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail